Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015LBK1

Protein Details
Accession A0A015LBK1    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
190-226DDKDRDYRSRSSRNDREYKPYDRRDRGRDRDRPGRRTBasic
NLS Segment(s)
PositionSequence
212-226RRDRGRDRDRPGRRT
Subcellular Location(s) nucl 21, cyto_nucl 14.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR011082  Exosome-assoc_fac/DNA_repair  
Gene Ontology GO:0005634  C:nucleus  
GO:0003723  F:RNA binding  
GO:0006364  P:rRNA processing  
Amino Acid Sequences MSETKDGKQVEISSKDSAPEDTELEVQTDSLFTKIRNTLSELEGGFDDVDSLLEPLLSQPLSELAPGLGPIDRARLYLLYGYTLNSLISLFLELKGQDSKIRILEEQYRRIQDCSEKINNTVNPPQPSLSINRDAASRFVKHALSNVKDRDRDTRENGRATSSGTHIRFNDDENFGGSSNNRTNNRFMRDDKDRDYRSRSSRNDREYKPYDRRDRGRDRDRPGRRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.37
3 0.34
4 0.31
5 0.25
6 0.22
7 0.2
8 0.18
9 0.2
10 0.18
11 0.18
12 0.17
13 0.14
14 0.12
15 0.11
16 0.1
17 0.09
18 0.1
19 0.09
20 0.15
21 0.19
22 0.21
23 0.22
24 0.26
25 0.27
26 0.28
27 0.31
28 0.25
29 0.23
30 0.2
31 0.19
32 0.15
33 0.11
34 0.1
35 0.06
36 0.06
37 0.05
38 0.05
39 0.04
40 0.04
41 0.04
42 0.04
43 0.07
44 0.06
45 0.06
46 0.06
47 0.07
48 0.08
49 0.08
50 0.08
51 0.06
52 0.06
53 0.06
54 0.07
55 0.06
56 0.06
57 0.06
58 0.09
59 0.1
60 0.1
61 0.11
62 0.1
63 0.11
64 0.12
65 0.12
66 0.1
67 0.1
68 0.1
69 0.1
70 0.1
71 0.09
72 0.07
73 0.07
74 0.05
75 0.05
76 0.06
77 0.05
78 0.05
79 0.06
80 0.06
81 0.08
82 0.09
83 0.09
84 0.1
85 0.11
86 0.13
87 0.14
88 0.15
89 0.14
90 0.16
91 0.24
92 0.27
93 0.32
94 0.33
95 0.34
96 0.33
97 0.33
98 0.32
99 0.27
100 0.26
101 0.26
102 0.28
103 0.26
104 0.27
105 0.32
106 0.32
107 0.31
108 0.34
109 0.33
110 0.3
111 0.3
112 0.29
113 0.25
114 0.25
115 0.26
116 0.24
117 0.23
118 0.21
119 0.21
120 0.21
121 0.21
122 0.22
123 0.21
124 0.18
125 0.16
126 0.17
127 0.18
128 0.17
129 0.22
130 0.25
131 0.26
132 0.31
133 0.35
134 0.38
135 0.39
136 0.41
137 0.44
138 0.45
139 0.47
140 0.48
141 0.53
142 0.53
143 0.54
144 0.53
145 0.48
146 0.41
147 0.37
148 0.32
149 0.25
150 0.28
151 0.25
152 0.28
153 0.26
154 0.3
155 0.28
156 0.29
157 0.31
158 0.25
159 0.24
160 0.22
161 0.23
162 0.19
163 0.19
164 0.16
165 0.17
166 0.2
167 0.28
168 0.3
169 0.31
170 0.38
171 0.44
172 0.5
173 0.49
174 0.48
175 0.49
176 0.54
177 0.59
178 0.59
179 0.61
180 0.6
181 0.61
182 0.64
183 0.64
184 0.64
185 0.67
186 0.69
187 0.7
188 0.74
189 0.78
190 0.81
191 0.78
192 0.78
193 0.75
194 0.76
195 0.76
196 0.77
197 0.78
198 0.78
199 0.82
200 0.83
201 0.87
202 0.88
203 0.88
204 0.87
205 0.85
206 0.86