Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015JT87

Protein Details
Accession A0A015JT87    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
98-120SINSNKSRKECRSYKRGFCKYGNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045348  CPSF4/Yth1  
IPR000571  Znf_CCCH  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
GO:0003723  F:RNA binding  
GO:0098789  P:pre-mRNA cleavage required for polyadenylation  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
Amino Acid Sequences MSKIDIFRPNLYNFKLDFEQFIHDKIIPQKKVEQSHDAIKKRRSANDIVCKHWLIGSCFRINCPYLHSYEFDHMPLCPTLKKFGSCNREVCVFSHSQSINSNKSRKECRSYKRGFCKYGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.36
3 0.32
4 0.3
5 0.25
6 0.28
7 0.25
8 0.26
9 0.23
10 0.2
11 0.23
12 0.3
13 0.37
14 0.34
15 0.35
16 0.41
17 0.46
18 0.53
19 0.53
20 0.51
21 0.45
22 0.52
23 0.58
24 0.58
25 0.57
26 0.54
27 0.57
28 0.55
29 0.57
30 0.52
31 0.5
32 0.53
33 0.57
34 0.56
35 0.52
36 0.5
37 0.45
38 0.41
39 0.36
40 0.28
41 0.21
42 0.24
43 0.24
44 0.25
45 0.24
46 0.25
47 0.25
48 0.24
49 0.2
50 0.18
51 0.16
52 0.16
53 0.17
54 0.18
55 0.17
56 0.18
57 0.19
58 0.16
59 0.14
60 0.12
61 0.13
62 0.12
63 0.12
64 0.12
65 0.12
66 0.17
67 0.19
68 0.21
69 0.23
70 0.31
71 0.38
72 0.4
73 0.42
74 0.39
75 0.41
76 0.4
77 0.37
78 0.33
79 0.27
80 0.24
81 0.28
82 0.26
83 0.24
84 0.29
85 0.33
86 0.36
87 0.42
88 0.47
89 0.44
90 0.52
91 0.59
92 0.61
93 0.65
94 0.67
95 0.69
96 0.75
97 0.79
98 0.82
99 0.84
100 0.86