Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015KDB5

Protein Details
Accession A0A015KDB5   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
19-43ATLLSYKAHRRKRLSKKLINKEYTWHydrophilic
NLS Segment(s)
PositionSequence
28-34RRKRLSK
Subcellular Location(s) cyto 18.5, cyto_nucl 11.5, nucl 3.5, cysk 3
Family & Domain DBs
Amino Acid Sequences MGEVQSGLFPLIQPGIIEATLLSYKAHRRKRLSKKLINKEYTWAIADLHGHPINSKRTGISAGILAYVFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.08
5 0.06
6 0.08
7 0.08
8 0.09
9 0.08
10 0.09
11 0.17
12 0.26
13 0.34
14 0.39
15 0.47
16 0.58
17 0.69
18 0.78
19 0.8
20 0.81
21 0.84
22 0.87
23 0.88
24 0.81
25 0.71
26 0.63
27 0.55
28 0.47
29 0.37
30 0.27
31 0.18
32 0.15
33 0.16
34 0.13
35 0.17
36 0.17
37 0.15
38 0.16
39 0.21
40 0.26
41 0.26
42 0.26
43 0.21
44 0.22
45 0.25
46 0.24
47 0.21
48 0.18
49 0.15
50 0.15