Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015LN43

Protein Details
Accession A0A015LN43    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
11-40CGKPYVQKIKLNNNKRTRRKPSKLCSDCEEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, mito 7, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSSKNYGSRTCGKPYVQKIKLNNNKRTRRKPSKLCSDCEETNDYIKLLSSKVSRIEEIVDNFKNLPKNKTENKLSVFNAKFSLNNVPCEMEYDLSNFTLENLQKLVIFTTQNCKPKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.66
3 0.65
4 0.66
5 0.67
6 0.72
7 0.77
8 0.78
9 0.79
10 0.78
11 0.82
12 0.86
13 0.89
14 0.89
15 0.9
16 0.91
17 0.91
18 0.91
19 0.91
20 0.87
21 0.8
22 0.75
23 0.71
24 0.61
25 0.54
26 0.48
27 0.37
28 0.34
29 0.29
30 0.24
31 0.16
32 0.16
33 0.13
34 0.09
35 0.11
36 0.1
37 0.11
38 0.15
39 0.17
40 0.16
41 0.16
42 0.18
43 0.18
44 0.18
45 0.21
46 0.17
47 0.17
48 0.17
49 0.19
50 0.22
51 0.21
52 0.22
53 0.22
54 0.29
55 0.35
56 0.42
57 0.45
58 0.45
59 0.47
60 0.5
61 0.47
62 0.49
63 0.44
64 0.38
65 0.35
66 0.3
67 0.26
68 0.23
69 0.31
70 0.24
71 0.26
72 0.25
73 0.25
74 0.24
75 0.27
76 0.26
77 0.17
78 0.15
79 0.15
80 0.15
81 0.14
82 0.14
83 0.1
84 0.1
85 0.15
86 0.15
87 0.15
88 0.14
89 0.15
90 0.15
91 0.16
92 0.17
93 0.14
94 0.16
95 0.16
96 0.24
97 0.31