Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3K4A1

Protein Details
Accession J3K4A1    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
56-75EAFRECWKRKGNDQRTQTKDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039870  Coa4-like  
Gene Ontology GO:0005758  C:mitochondrial intermembrane space  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
KEGG cim:CIMG_07857  -  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MSKVDDKARIVPVEDDDEPDDWDKRIFSTGCSVEQTKMNDCYFEKRDWRQCSKEMEAFRECWKRKGNDQRTQTKDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.26
3 0.22
4 0.22
5 0.21
6 0.21
7 0.19
8 0.14
9 0.15
10 0.12
11 0.11
12 0.15
13 0.14
14 0.13
15 0.18
16 0.19
17 0.2
18 0.23
19 0.23
20 0.2
21 0.23
22 0.24
23 0.2
24 0.23
25 0.21
26 0.2
27 0.2
28 0.25
29 0.24
30 0.26
31 0.3
32 0.33
33 0.42
34 0.48
35 0.55
36 0.53
37 0.56
38 0.59
39 0.59
40 0.58
41 0.52
42 0.5
43 0.46
44 0.44
45 0.46
46 0.5
47 0.45
48 0.47
49 0.51
50 0.5
51 0.58
52 0.67
53 0.7
54 0.69
55 0.77
56 0.81