Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015N8R0

Protein Details
Accession A0A015N8R0   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
99-127AVSQEKRAQDKKRAQKKERRSIVWKVDENHydrophilic
NLS Segment(s)
PositionSequence
105-118RAQDKKRAQKKERR
Subcellular Location(s) extr 11, golg 5, E.R. 4, mito 3, nucl 2
Family & Domain DBs
Amino Acid Sequences MYKLNIIIIFFLCIAAIFTNAAPLNTVPQNPSSSLTARSALNLNSDASAIYHAKKRRGIIIPELDLSDSDTIRPKIIKNRMIKRNPINYNAANHSTKDAVSQEKRAQDKKRAQKKERRSIVWKVDENILFKRNEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.07
4 0.07
5 0.06
6 0.11
7 0.11
8 0.11
9 0.11
10 0.11
11 0.15
12 0.17
13 0.18
14 0.15
15 0.17
16 0.19
17 0.19
18 0.22
19 0.2
20 0.2
21 0.21
22 0.22
23 0.21
24 0.19
25 0.2
26 0.19
27 0.17
28 0.18
29 0.16
30 0.14
31 0.12
32 0.12
33 0.11
34 0.09
35 0.11
36 0.09
37 0.1
38 0.15
39 0.18
40 0.23
41 0.26
42 0.27
43 0.32
44 0.36
45 0.38
46 0.39
47 0.41
48 0.38
49 0.35
50 0.34
51 0.27
52 0.21
53 0.19
54 0.13
55 0.08
56 0.07
57 0.1
58 0.1
59 0.11
60 0.12
61 0.13
62 0.21
63 0.29
64 0.35
65 0.41
66 0.51
67 0.6
68 0.64
69 0.7
70 0.7
71 0.72
72 0.69
73 0.64
74 0.6
75 0.52
76 0.51
77 0.48
78 0.44
79 0.36
80 0.32
81 0.29
82 0.24
83 0.22
84 0.2
85 0.19
86 0.22
87 0.23
88 0.29
89 0.32
90 0.38
91 0.45
92 0.5
93 0.55
94 0.57
95 0.64
96 0.69
97 0.75
98 0.79
99 0.83
100 0.85
101 0.9
102 0.91
103 0.9
104 0.88
105 0.84
106 0.83
107 0.83
108 0.82
109 0.75
110 0.67
111 0.65
112 0.6
113 0.57
114 0.52
115 0.47