Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0E1RZS5

Protein Details
Accession A0A0E1RZS5   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
30-49IKKTCEKKCREIHRERVSKCBasic
NLS Segment(s)
Subcellular Location(s) extr 10, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
KEGG cim:CIMG_00334  -  
Amino Acid Sequences MKLSVYLCFLLSAVYVAAGAIPKNKRDNEIKKTCEKKCREIHRERVSKCEGLKDGKDKCLKSAALLGSDKGQKQCVVPCVASIFGPHKGGLFADFYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.04
4 0.05
5 0.06
6 0.06
7 0.12
8 0.14
9 0.18
10 0.25
11 0.26
12 0.31
13 0.4
14 0.49
15 0.53
16 0.6
17 0.61
18 0.65
19 0.72
20 0.74
21 0.74
22 0.7
23 0.69
24 0.69
25 0.74
26 0.75
27 0.75
28 0.79
29 0.8
30 0.83
31 0.74
32 0.71
33 0.64
34 0.57
35 0.48
36 0.42
37 0.34
38 0.29
39 0.31
40 0.32
41 0.31
42 0.35
43 0.4
44 0.36
45 0.35
46 0.37
47 0.34
48 0.28
49 0.31
50 0.25
51 0.24
52 0.24
53 0.23
54 0.22
55 0.25
56 0.26
57 0.22
58 0.22
59 0.19
60 0.21
61 0.25
62 0.26
63 0.26
64 0.24
65 0.24
66 0.25
67 0.24
68 0.22
69 0.2
70 0.19
71 0.18
72 0.2
73 0.18
74 0.17
75 0.17
76 0.17
77 0.16