Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015IZ44

Protein Details
Accession A0A015IZ44    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
157-176YMLPRHKKKKEWFPDWIHYSHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 10, E.R. 8, mito 4, golg 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR005821  Ion_trans_dom  
IPR024862  TRPV  
Gene Ontology GO:0016020  C:membrane  
GO:0005216  F:monoatomic ion channel activity  
Pfam View protein in Pfam  
PF00520  Ion_trans  
Amino Acid Sequences MIGVGRKIIPFLVILLFIILGFAHAFFILLRSTKNDDENDPLNLAVKYNSVNSDGTINSNPTLIQPPDSNTNMFNYFPTSLLAMYLLLIGDSGSLSPWTYRESHTMTFLLFLFTFFTVIYLMNLFIGLLNMAIEKYDNYEEFLLQKAKVIMEIELFYMLPRHKKKKEWFPDWIHYSIPANEVRKFIIAIDKNKTGFKFDPPRC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.07
5 0.07
6 0.05
7 0.05
8 0.04
9 0.04
10 0.05
11 0.04
12 0.05
13 0.05
14 0.06
15 0.07
16 0.08
17 0.09
18 0.13
19 0.18
20 0.21
21 0.25
22 0.27
23 0.27
24 0.32
25 0.34
26 0.32
27 0.27
28 0.25
29 0.22
30 0.2
31 0.18
32 0.13
33 0.11
34 0.11
35 0.12
36 0.13
37 0.13
38 0.13
39 0.13
40 0.15
41 0.14
42 0.16
43 0.16
44 0.16
45 0.14
46 0.14
47 0.13
48 0.12
49 0.17
50 0.14
51 0.15
52 0.14
53 0.17
54 0.22
55 0.23
56 0.23
57 0.19
58 0.21
59 0.21
60 0.2
61 0.18
62 0.15
63 0.14
64 0.14
65 0.14
66 0.11
67 0.09
68 0.09
69 0.09
70 0.06
71 0.05
72 0.05
73 0.04
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.02
80 0.03
81 0.03
82 0.03
83 0.03
84 0.04
85 0.06
86 0.08
87 0.09
88 0.13
89 0.16
90 0.17
91 0.18
92 0.18
93 0.16
94 0.16
95 0.15
96 0.13
97 0.09
98 0.08
99 0.08
100 0.07
101 0.08
102 0.06
103 0.06
104 0.06
105 0.06
106 0.06
107 0.05
108 0.05
109 0.05
110 0.05
111 0.04
112 0.04
113 0.04
114 0.03
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.03
122 0.06
123 0.08
124 0.08
125 0.1
126 0.11
127 0.11
128 0.12
129 0.15
130 0.14
131 0.13
132 0.14
133 0.14
134 0.13
135 0.14
136 0.14
137 0.12
138 0.11
139 0.12
140 0.11
141 0.1
142 0.1
143 0.08
144 0.11
145 0.13
146 0.2
147 0.28
148 0.37
149 0.43
150 0.52
151 0.62
152 0.7
153 0.79
154 0.78
155 0.8
156 0.79
157 0.82
158 0.78
159 0.7
160 0.59
161 0.51
162 0.46
163 0.37
164 0.33
165 0.29
166 0.27
167 0.28
168 0.29
169 0.28
170 0.26
171 0.25
172 0.23
173 0.27
174 0.3
175 0.33
176 0.38
177 0.42
178 0.43
179 0.47
180 0.47
181 0.44
182 0.39
183 0.44