Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015L154

Protein Details
Accession A0A015L154    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
92-117VESQVDKKRERHCKKCDQPGHYAPRCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MGYAKKALDLAVQTDKVDEFVDQVKYFIENTKAELSEQQENLTSMHIGDPLRVQHKGRQPNKYKSCGESQRKKSKYIRDITNITNKNCKEVVESQVDKKRERHCKKCDQPGHYAPRCPNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.2
4 0.19
5 0.14
6 0.1
7 0.13
8 0.17
9 0.16
10 0.16
11 0.15
12 0.16
13 0.17
14 0.18
15 0.18
16 0.15
17 0.18
18 0.21
19 0.21
20 0.21
21 0.23
22 0.24
23 0.25
24 0.25
25 0.23
26 0.2
27 0.2
28 0.2
29 0.17
30 0.14
31 0.08
32 0.08
33 0.1
34 0.09
35 0.08
36 0.1
37 0.12
38 0.14
39 0.16
40 0.17
41 0.2
42 0.28
43 0.38
44 0.42
45 0.5
46 0.56
47 0.65
48 0.7
49 0.7
50 0.65
51 0.58
52 0.6
53 0.6
54 0.61
55 0.61
56 0.65
57 0.69
58 0.69
59 0.73
60 0.72
61 0.71
62 0.71
63 0.69
64 0.66
65 0.62
66 0.64
67 0.62
68 0.65
69 0.6
70 0.53
71 0.53
72 0.46
73 0.43
74 0.4
75 0.36
76 0.31
77 0.3
78 0.33
79 0.34
80 0.37
81 0.4
82 0.47
83 0.5
84 0.48
85 0.51
86 0.55
87 0.58
88 0.65
89 0.68
90 0.71
91 0.79
92 0.85
93 0.89
94 0.89
95 0.84
96 0.83
97 0.83
98 0.84
99 0.78
100 0.75