Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015KEK4

Protein Details
Accession A0A015KEK4   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
140-161VYKDTKRYSRVKVKNDNSSWRKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
Amino Acid Sequences MGKTRIKNKDEFYESKMETEWKFRKEVVEQINRRMLEYDEDTDIIILDKSPYCEYYYQKTKSFDRGLITPYGNHEMEKEIFRLKDTIDKSIVIFLEKDGDVCWKNYIGRETKKTEKSSYPTLKKDEYLDMVKMFEENQSVYKDTKRYSRVKVKNDNSSWRKVFKEVEKWRRAQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.49
3 0.45
4 0.4
5 0.34
6 0.4
7 0.41
8 0.35
9 0.37
10 0.37
11 0.4
12 0.39
13 0.46
14 0.46
15 0.49
16 0.5
17 0.54
18 0.59
19 0.54
20 0.51
21 0.44
22 0.35
23 0.29
24 0.3
25 0.26
26 0.21
27 0.21
28 0.2
29 0.18
30 0.17
31 0.12
32 0.09
33 0.06
34 0.06
35 0.07
36 0.09
37 0.11
38 0.12
39 0.13
40 0.17
41 0.2
42 0.27
43 0.35
44 0.37
45 0.41
46 0.44
47 0.45
48 0.49
49 0.49
50 0.44
51 0.37
52 0.35
53 0.33
54 0.32
55 0.29
56 0.22
57 0.21
58 0.23
59 0.2
60 0.18
61 0.16
62 0.15
63 0.16
64 0.17
65 0.15
66 0.13
67 0.13
68 0.14
69 0.14
70 0.12
71 0.17
72 0.17
73 0.18
74 0.17
75 0.17
76 0.17
77 0.18
78 0.18
79 0.12
80 0.11
81 0.08
82 0.1
83 0.09
84 0.09
85 0.07
86 0.11
87 0.11
88 0.11
89 0.12
90 0.11
91 0.12
92 0.15
93 0.19
94 0.23
95 0.28
96 0.33
97 0.39
98 0.46
99 0.52
100 0.54
101 0.53
102 0.52
103 0.52
104 0.56
105 0.61
106 0.59
107 0.57
108 0.58
109 0.56
110 0.51
111 0.49
112 0.42
113 0.37
114 0.32
115 0.29
116 0.25
117 0.23
118 0.22
119 0.19
120 0.16
121 0.12
122 0.11
123 0.1
124 0.12
125 0.14
126 0.16
127 0.17
128 0.22
129 0.25
130 0.26
131 0.34
132 0.39
133 0.44
134 0.52
135 0.61
136 0.66
137 0.72
138 0.8
139 0.8
140 0.83
141 0.82
142 0.83
143 0.78
144 0.78
145 0.73
146 0.68
147 0.62
148 0.57
149 0.58
150 0.56
151 0.61
152 0.63
153 0.69
154 0.72