Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015I8Y3

Protein Details
Accession A0A015I8Y3    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
28-54GSQNWDKPIRPRKMKWSKKRQGYYDPTHydrophilic
NLS Segment(s)
PositionSequence
36-47IRPRKMKWSKKR
Subcellular Location(s) nucl 20.5, cyto_nucl 12, cyto 2.5, mito 2
Family & Domain DBs
Amino Acid Sequences MDDREIPSGTTIPRYTPERTGQNFVNGGSQNWDKPIRPRKMKWSKKRQGYYDPTEGLRKWREAGGPTNPKQYGPRLIDEIPPYDVVGDIKSCRANITFGQLVNENNKYHKQLREEIYKPRSINEKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.34
4 0.4
5 0.43
6 0.46
7 0.49
8 0.46
9 0.47
10 0.45
11 0.39
12 0.38
13 0.29
14 0.26
15 0.25
16 0.25
17 0.2
18 0.23
19 0.25
20 0.21
21 0.3
22 0.4
23 0.45
24 0.52
25 0.56
26 0.63
27 0.72
28 0.81
29 0.82
30 0.84
31 0.83
32 0.85
33 0.88
34 0.83
35 0.81
36 0.79
37 0.74
38 0.69
39 0.61
40 0.52
41 0.48
42 0.42
43 0.37
44 0.31
45 0.25
46 0.2
47 0.2
48 0.2
49 0.2
50 0.24
51 0.28
52 0.34
53 0.35
54 0.39
55 0.38
56 0.37
57 0.36
58 0.35
59 0.34
60 0.29
61 0.29
62 0.27
63 0.28
64 0.31
65 0.3
66 0.29
67 0.22
68 0.19
69 0.17
70 0.13
71 0.13
72 0.09
73 0.09
74 0.09
75 0.08
76 0.1
77 0.12
78 0.12
79 0.13
80 0.13
81 0.15
82 0.14
83 0.21
84 0.21
85 0.2
86 0.22
87 0.22
88 0.23
89 0.26
90 0.29
91 0.24
92 0.25
93 0.29
94 0.33
95 0.37
96 0.41
97 0.42
98 0.47
99 0.53
100 0.59
101 0.6
102 0.64
103 0.64
104 0.65
105 0.59
106 0.56