Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015JTN6

Protein Details
Accession A0A015JTN6    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
24-45DFNLQYRRFKKRQDNKQSIPKMHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, mito_nucl 12.333, nucl 9, cyto_nucl 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR036691  Endo/exonu/phosph_ase_sf  
Amino Acid Sequences MNTHVIKQIKKAKSQKMEIICCGDFNLQYRRFKKRQDNKQSIPKMLKIFQKLEDLNLWDVHKETYDMDNTKEIMTYWCFI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.73
3 0.72
4 0.71
5 0.64
6 0.61
7 0.51
8 0.42
9 0.37
10 0.3
11 0.22
12 0.21
13 0.27
14 0.26
15 0.34
16 0.38
17 0.45
18 0.48
19 0.56
20 0.63
21 0.65
22 0.71
23 0.74
24 0.8
25 0.78
26 0.84
27 0.79
28 0.73
29 0.66
30 0.59
31 0.51
32 0.46
33 0.45
34 0.39
35 0.37
36 0.35
37 0.38
38 0.34
39 0.33
40 0.3
41 0.27
42 0.24
43 0.24
44 0.22
45 0.16
46 0.17
47 0.15
48 0.13
49 0.12
50 0.12
51 0.14
52 0.19
53 0.2
54 0.22
55 0.24
56 0.25
57 0.24
58 0.22
59 0.19
60 0.17