Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015JSW2

Protein Details
Accession A0A015JSW2   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
153-179ILITMKKKEKTVKRKKKESNSDNEETIHydrophilic
NLS Segment(s)
PositionSequence
158-169KKKEKTVKRKKK
Subcellular Location(s) nucl 19, cyto_nucl 13.333, mito_nucl 11.999, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MGETRNTGIKETGKTGRIDTTKVIDLEVTSSEVSTTIIQRESRYNDNSETENDDGELELEVNYKLVIKQADGTVLPAKNYSVTVSELDEFLLAIQNNIVTLLKDEEINANDYNVSFKSEKAQGAGTLLVDMCDFRNFQSEYIKLAATKKIILILITMKKKEKTVKRKKKESNSDNEETICSKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.37
3 0.41
4 0.38
5 0.37
6 0.34
7 0.33
8 0.33
9 0.32
10 0.3
11 0.22
12 0.2
13 0.2
14 0.18
15 0.14
16 0.1
17 0.1
18 0.09
19 0.09
20 0.1
21 0.1
22 0.1
23 0.11
24 0.14
25 0.16
26 0.17
27 0.23
28 0.27
29 0.31
30 0.33
31 0.34
32 0.33
33 0.35
34 0.35
35 0.31
36 0.31
37 0.25
38 0.22
39 0.19
40 0.16
41 0.14
42 0.12
43 0.1
44 0.06
45 0.05
46 0.06
47 0.05
48 0.05
49 0.05
50 0.05
51 0.05
52 0.08
53 0.08
54 0.08
55 0.09
56 0.1
57 0.11
58 0.11
59 0.13
60 0.14
61 0.14
62 0.14
63 0.13
64 0.12
65 0.11
66 0.12
67 0.11
68 0.08
69 0.09
70 0.09
71 0.1
72 0.1
73 0.1
74 0.09
75 0.08
76 0.07
77 0.05
78 0.07
79 0.05
80 0.05
81 0.05
82 0.05
83 0.05
84 0.05
85 0.05
86 0.03
87 0.04
88 0.06
89 0.06
90 0.06
91 0.07
92 0.08
93 0.09
94 0.12
95 0.11
96 0.1
97 0.1
98 0.1
99 0.11
100 0.09
101 0.12
102 0.1
103 0.1
104 0.14
105 0.18
106 0.18
107 0.18
108 0.19
109 0.15
110 0.16
111 0.16
112 0.12
113 0.09
114 0.09
115 0.07
116 0.06
117 0.07
118 0.06
119 0.07
120 0.07
121 0.07
122 0.13
123 0.14
124 0.15
125 0.21
126 0.21
127 0.22
128 0.24
129 0.24
130 0.2
131 0.22
132 0.24
133 0.2
134 0.2
135 0.18
136 0.19
137 0.19
138 0.17
139 0.16
140 0.2
141 0.26
142 0.31
143 0.33
144 0.35
145 0.37
146 0.43
147 0.51
148 0.55
149 0.58
150 0.64
151 0.73
152 0.79
153 0.88
154 0.93
155 0.94
156 0.95
157 0.93
158 0.93
159 0.9
160 0.85
161 0.77
162 0.68
163 0.59