Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015L5T5

Protein Details
Accession A0A015L5T5   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
43-72GGGLYDYKNKKHKKKKHKNKNYSRHFINKRBasic
NLS Segment(s)
PositionSequence
50-63KNKKHKKKKHKNKN
Subcellular Location(s) mito 13, nucl 5, cyto 4, extr 4
Family & Domain DBs
Amino Acid Sequences MRKHNLIVLIAIVIILCLTTLSNGSVIKSNLVKRKQDTPYTEGGGLYDYKNKKHKKKKHKNKNYSRHFINKRDDDVPEPDLGEVSVGQEEKANLQKRQTPPVSTGHVDASKTNPGQSGNP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.03
3 0.03
4 0.03
5 0.03
6 0.03
7 0.04
8 0.05
9 0.07
10 0.08
11 0.09
12 0.13
13 0.13
14 0.16
15 0.19
16 0.25
17 0.31
18 0.37
19 0.41
20 0.41
21 0.5
22 0.53
23 0.56
24 0.56
25 0.52
26 0.51
27 0.48
28 0.45
29 0.36
30 0.29
31 0.23
32 0.18
33 0.15
34 0.17
35 0.16
36 0.2
37 0.29
38 0.37
39 0.46
40 0.56
41 0.66
42 0.71
43 0.81
44 0.88
45 0.91
46 0.94
47 0.95
48 0.95
49 0.96
50 0.94
51 0.9
52 0.84
53 0.83
54 0.78
55 0.75
56 0.73
57 0.66
58 0.6
59 0.55
60 0.51
61 0.43
62 0.4
63 0.34
64 0.25
65 0.21
66 0.17
67 0.15
68 0.13
69 0.1
70 0.07
71 0.05
72 0.06
73 0.06
74 0.06
75 0.08
76 0.08
77 0.11
78 0.19
79 0.24
80 0.24
81 0.28
82 0.36
83 0.39
84 0.48
85 0.5
86 0.45
87 0.43
88 0.47
89 0.49
90 0.43
91 0.41
92 0.37
93 0.35
94 0.33
95 0.31
96 0.29
97 0.31
98 0.3
99 0.29
100 0.26