Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0E1S3U1

Protein Details
Accession A0A0E1S3U1   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
75-101SVQFTKLVLEKQKKKKEKKKKKKKKKKBasic
NLS Segment(s)
PositionSequence
85-101KQKKKKEKKKKKKKKKK
Subcellular Location(s) cyto 10.5, mito 9, cyto_nucl 8, nucl 4.5
Family & Domain DBs
KEGG cim:CIMG_13450  -  
Amino Acid Sequences MAHCNTKIGLNYFGLIDVSDCPVSAVTICCLYAAPALSTTVAAAPPPLPLLTTVSLSLSGTVRVSVCQMMNIRASVQFTKLVLEKQKKKKEKKKKKKKKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.13
3 0.11
4 0.08
5 0.1
6 0.09
7 0.09
8 0.09
9 0.09
10 0.09
11 0.09
12 0.09
13 0.07
14 0.08
15 0.08
16 0.08
17 0.08
18 0.08
19 0.09
20 0.09
21 0.08
22 0.07
23 0.08
24 0.08
25 0.08
26 0.07
27 0.06
28 0.06
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.08
38 0.08
39 0.09
40 0.09
41 0.08
42 0.09
43 0.08
44 0.09
45 0.07
46 0.07
47 0.06
48 0.07
49 0.06
50 0.06
51 0.08
52 0.09
53 0.08
54 0.11
55 0.12
56 0.14
57 0.15
58 0.15
59 0.15
60 0.14
61 0.17
62 0.15
63 0.15
64 0.15
65 0.14
66 0.17
67 0.18
68 0.21
69 0.28
70 0.37
71 0.46
72 0.55
73 0.65
74 0.73
75 0.83
76 0.89
77 0.91
78 0.93
79 0.94
80 0.95
81 0.96