Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015K0P3

Protein Details
Accession A0A015K0P3   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
126-153DNLHKEKYPDYKLKSRRKKSTVNFSVKIHydrophilic
NLS Segment(s)
PositionSequence
50-59SEKKNGRAKR
Subcellular Location(s) nucl 24.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
Amino Acid Sequences MAAKRNVPNKQDILNHYDEHLNEINETVDKLLNAIKIDDIPNAIKFLPKSEKKNGRAKRPPNSNILCSNQLMNFGIRKIAENICEKYDYDKQRILILSRQFTGRIWKEIISVETKQYFENLAKDIDNLHKEKYPDYKLKSRRKKSTVNFSVKIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.46
3 0.4
4 0.4
5 0.33
6 0.32
7 0.3
8 0.24
9 0.2
10 0.2
11 0.19
12 0.16
13 0.16
14 0.11
15 0.09
16 0.09
17 0.09
18 0.11
19 0.12
20 0.12
21 0.12
22 0.12
23 0.13
24 0.14
25 0.14
26 0.14
27 0.13
28 0.13
29 0.14
30 0.14
31 0.14
32 0.13
33 0.18
34 0.25
35 0.3
36 0.36
37 0.45
38 0.54
39 0.59
40 0.69
41 0.71
42 0.73
43 0.77
44 0.79
45 0.78
46 0.79
47 0.75
48 0.74
49 0.71
50 0.63
51 0.58
52 0.53
53 0.46
54 0.36
55 0.33
56 0.24
57 0.22
58 0.19
59 0.15
60 0.12
61 0.09
62 0.1
63 0.09
64 0.1
65 0.11
66 0.12
67 0.14
68 0.18
69 0.19
70 0.19
71 0.2
72 0.19
73 0.21
74 0.28
75 0.28
76 0.28
77 0.29
78 0.29
79 0.31
80 0.32
81 0.3
82 0.28
83 0.29
84 0.28
85 0.26
86 0.26
87 0.23
88 0.23
89 0.29
90 0.26
91 0.24
92 0.23
93 0.23
94 0.24
95 0.25
96 0.26
97 0.22
98 0.2
99 0.21
100 0.22
101 0.22
102 0.2
103 0.2
104 0.2
105 0.18
106 0.19
107 0.17
108 0.17
109 0.16
110 0.16
111 0.18
112 0.22
113 0.26
114 0.25
115 0.26
116 0.28
117 0.29
118 0.33
119 0.39
120 0.41
121 0.44
122 0.5
123 0.57
124 0.64
125 0.74
126 0.81
127 0.83
128 0.85
129 0.85
130 0.88
131 0.88
132 0.89
133 0.89
134 0.87