Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015JCH0

Protein Details
Accession A0A015JCH0    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
41-67VDKTPNIPWEKKKNKKVEKCIKDLTREHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto 5, pero 2
Family & Domain DBs
Amino Acid Sequences MSISANKSINGTSDISCVSEYWYENGDNPAVFYGQSPDTTVDKTPNIPWEKKKNKKVEKCIKDLTRELLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.16
4 0.14
5 0.13
6 0.13
7 0.13
8 0.13
9 0.14
10 0.14
11 0.14
12 0.16
13 0.14
14 0.11
15 0.11
16 0.1
17 0.08
18 0.08
19 0.07
20 0.08
21 0.08
22 0.08
23 0.09
24 0.1
25 0.11
26 0.12
27 0.13
28 0.13
29 0.14
30 0.15
31 0.16
32 0.22
33 0.27
34 0.31
35 0.38
36 0.47
37 0.57
38 0.66
39 0.73
40 0.77
41 0.82
42 0.87
43 0.91
44 0.91
45 0.88
46 0.86
47 0.87
48 0.82
49 0.78
50 0.72