Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015J977

Protein Details
Accession A0A015J977    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
284-305FIGKTLPKINKSKKKITRTIFLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 11.333, mito_nucl 10.333, cyto 4.5, mito 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004808  AP_endonuc_1  
IPR036691  Endo/exonu/phosph_ase_sf  
IPR005135  Endo/exonuclease/phosphatase  
Gene Ontology GO:0004518  F:nuclease activity  
GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF14529  Exo_endo_phos_2  
Amino Acid Sequences MNNNIISPSSSNIQQQKNFPQIENNNPIITKDSLKNFSITKIATTNIRTLSKVKLIFTLDAMKNNDIDIYGLAETNLSYRQSKIWQQQFGFCGYFDYSQQGGKGQGVGIIISDKYDIFVHKAVGHKGRVIYLDLNFSQKKNVRLLQVYINANKKERTQIEELYQYIENVIDDAKNKNMEIIIMGDFNINYRKYLMSFVNNRWYFKLFKMLENRHLLDTIPIFNEDDENIYTYIPPNDSNEKSRIDYIWASLPILGQSLNSTVIENDHCTTDHNTVTLSLDTQLFIGKTLPKINKSKKKITRTIFLYDEMDRDDDEFTWDNFRAGLDQEIERLKLKDRSITKRKHVDHVWDSLRQLIMKSANENIKTKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.5
3 0.56
4 0.62
5 0.62
6 0.56
7 0.58
8 0.57
9 0.62
10 0.62
11 0.56
12 0.49
13 0.46
14 0.46
15 0.4
16 0.35
17 0.31
18 0.29
19 0.33
20 0.36
21 0.37
22 0.39
23 0.36
24 0.36
25 0.36
26 0.3
27 0.27
28 0.24
29 0.24
30 0.27
31 0.28
32 0.31
33 0.31
34 0.33
35 0.31
36 0.32
37 0.35
38 0.37
39 0.37
40 0.34
41 0.33
42 0.34
43 0.33
44 0.33
45 0.36
46 0.31
47 0.34
48 0.36
49 0.32
50 0.29
51 0.29
52 0.26
53 0.17
54 0.16
55 0.1
56 0.09
57 0.09
58 0.08
59 0.08
60 0.08
61 0.08
62 0.08
63 0.1
64 0.1
65 0.11
66 0.12
67 0.15
68 0.21
69 0.28
70 0.37
71 0.42
72 0.48
73 0.48
74 0.53
75 0.51
76 0.5
77 0.42
78 0.33
79 0.27
80 0.22
81 0.21
82 0.16
83 0.19
84 0.16
85 0.16
86 0.16
87 0.15
88 0.14
89 0.14
90 0.14
91 0.1
92 0.11
93 0.1
94 0.09
95 0.08
96 0.08
97 0.07
98 0.07
99 0.07
100 0.05
101 0.07
102 0.07
103 0.08
104 0.1
105 0.11
106 0.12
107 0.14
108 0.18
109 0.21
110 0.25
111 0.26
112 0.25
113 0.25
114 0.25
115 0.24
116 0.23
117 0.21
118 0.17
119 0.2
120 0.18
121 0.22
122 0.22
123 0.21
124 0.25
125 0.27
126 0.29
127 0.31
128 0.34
129 0.33
130 0.34
131 0.36
132 0.35
133 0.38
134 0.38
135 0.37
136 0.39
137 0.36
138 0.35
139 0.35
140 0.31
141 0.31
142 0.3
143 0.31
144 0.29
145 0.3
146 0.32
147 0.33
148 0.32
149 0.28
150 0.26
151 0.2
152 0.16
153 0.13
154 0.1
155 0.07
156 0.07
157 0.05
158 0.06
159 0.07
160 0.09
161 0.1
162 0.1
163 0.1
164 0.1
165 0.09
166 0.08
167 0.09
168 0.07
169 0.07
170 0.07
171 0.07
172 0.06
173 0.07
174 0.1
175 0.08
176 0.08
177 0.09
178 0.09
179 0.1
180 0.13
181 0.15
182 0.18
183 0.22
184 0.25
185 0.34
186 0.35
187 0.35
188 0.34
189 0.34
190 0.3
191 0.26
192 0.33
193 0.24
194 0.28
195 0.37
196 0.39
197 0.44
198 0.47
199 0.47
200 0.38
201 0.37
202 0.32
203 0.24
204 0.22
205 0.16
206 0.12
207 0.11
208 0.1
209 0.1
210 0.11
211 0.09
212 0.09
213 0.08
214 0.09
215 0.09
216 0.09
217 0.09
218 0.09
219 0.11
220 0.1
221 0.1
222 0.12
223 0.18
224 0.21
225 0.25
226 0.27
227 0.28
228 0.29
229 0.3
230 0.27
231 0.24
232 0.22
233 0.2
234 0.21
235 0.19
236 0.17
237 0.16
238 0.16
239 0.12
240 0.12
241 0.1
242 0.06
243 0.06
244 0.07
245 0.08
246 0.08
247 0.08
248 0.08
249 0.1
250 0.11
251 0.12
252 0.12
253 0.12
254 0.12
255 0.14
256 0.17
257 0.19
258 0.18
259 0.16
260 0.15
261 0.15
262 0.17
263 0.15
264 0.12
265 0.1
266 0.1
267 0.1
268 0.1
269 0.11
270 0.09
271 0.09
272 0.11
273 0.12
274 0.15
275 0.22
276 0.27
277 0.32
278 0.42
279 0.53
280 0.61
281 0.66
282 0.74
283 0.76
284 0.82
285 0.85
286 0.81
287 0.8
288 0.75
289 0.73
290 0.65
291 0.58
292 0.51
293 0.42
294 0.38
295 0.3
296 0.25
297 0.19
298 0.17
299 0.15
300 0.12
301 0.16
302 0.16
303 0.15
304 0.19
305 0.19
306 0.18
307 0.17
308 0.17
309 0.15
310 0.14
311 0.16
312 0.15
313 0.15
314 0.18
315 0.2
316 0.22
317 0.23
318 0.23
319 0.26
320 0.29
321 0.31
322 0.35
323 0.42
324 0.51
325 0.59
326 0.67
327 0.72
328 0.76
329 0.78
330 0.79
331 0.77
332 0.77
333 0.72
334 0.72
335 0.67
336 0.61
337 0.57
338 0.52
339 0.47
340 0.38
341 0.33
342 0.29
343 0.3
344 0.28
345 0.3
346 0.33
347 0.39
348 0.42