Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015I1D1

Protein Details
Accession A0A015I1D1    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
42-61EKLRKKPRILKIKRVQRCKTBasic
NLS Segment(s)
PositionSequence
45-54RKKPRILKIK
Subcellular Location(s) E.R. 7, golg 6, nucl 3, mito 3, plas 3, mito_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVAFFCSMYYIFIIIFFILFINSNYLLKLQRLLHDRIDLTVEKLRKKPRILKIKRVQRCKTTTSMPPMDTPNWCLTDKALKRFNRSTNEIPTYDYNTDQDKESDEYHND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.05
5 0.05
6 0.06
7 0.06
8 0.08
9 0.1
10 0.1
11 0.1
12 0.12
13 0.13
14 0.13
15 0.17
16 0.16
17 0.21
18 0.26
19 0.29
20 0.29
21 0.31
22 0.31
23 0.26
24 0.28
25 0.22
26 0.2
27 0.22
28 0.23
29 0.23
30 0.29
31 0.35
32 0.38
33 0.44
34 0.51
35 0.56
36 0.64
37 0.67
38 0.72
39 0.74
40 0.78
41 0.79
42 0.8
43 0.75
44 0.72
45 0.7
46 0.63
47 0.57
48 0.52
49 0.5
50 0.47
51 0.47
52 0.4
53 0.37
54 0.37
55 0.35
56 0.31
57 0.29
58 0.25
59 0.24
60 0.23
61 0.21
62 0.2
63 0.28
64 0.31
65 0.36
66 0.41
67 0.41
68 0.49
69 0.56
70 0.61
71 0.59
72 0.61
73 0.6
74 0.61
75 0.62
76 0.55
77 0.52
78 0.48
79 0.46
80 0.41
81 0.36
82 0.3
83 0.29
84 0.29
85 0.28
86 0.25
87 0.23
88 0.24
89 0.25