Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015LF23

Protein Details
Accession A0A015LF23    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
26-48KRGYDQLLRRRRRNRIYRRYSLIHydrophilic
NLS Segment(s)
PositionSequence
34-39RRRRRN
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MASSSQNSSPINITDNSEILEKPLRKRGYDQLLRRRRRNRIYRRYSLISIEETLMRLPQQIITNNPQLDQFFNGSQFT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.19
4 0.18
5 0.16
6 0.16
7 0.22
8 0.22
9 0.24
10 0.32
11 0.33
12 0.33
13 0.38
14 0.44
15 0.47
16 0.53
17 0.58
18 0.6
19 0.68
20 0.74
21 0.78
22 0.78
23 0.76
24 0.78
25 0.8
26 0.8
27 0.81
28 0.83
29 0.81
30 0.8
31 0.75
32 0.67
33 0.58
34 0.49
35 0.4
36 0.32
37 0.26
38 0.19
39 0.15
40 0.14
41 0.12
42 0.1
43 0.09
44 0.08
45 0.11
46 0.15
47 0.17
48 0.22
49 0.27
50 0.34
51 0.33
52 0.33
53 0.32
54 0.29
55 0.28
56 0.27
57 0.25
58 0.2