Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015I4S0

Protein Details
Accession A0A015I4S0    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MQFEKPRRPMRIRYRNSKKKAEVRKRDPLPESBasic
NLS Segment(s)
PositionSequence
5-26KPRRPMRIRYRNSKKKAEVRKR
Subcellular Location(s) nucl 12, mito_nucl 11, mito 8, cyto 7
Family & Domain DBs
Amino Acid Sequences MQFEKPRRPMRIRYRNSKKKAEVRKRDPLPESSVLLDCKFANVVIDAIYPCEDFVLTNEGIYLGKCFHTWGHLQHLNQKFKTTPPKKATWVYDWKGPKAKCWC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.89
4 0.88
5 0.86
6 0.85
7 0.87
8 0.87
9 0.87
10 0.85
11 0.88
12 0.84
13 0.82
14 0.75
15 0.68
16 0.63
17 0.55
18 0.48
19 0.39
20 0.36
21 0.29
22 0.25
23 0.23
24 0.16
25 0.13
26 0.12
27 0.09
28 0.08
29 0.07
30 0.07
31 0.05
32 0.06
33 0.06
34 0.06
35 0.07
36 0.06
37 0.05
38 0.05
39 0.05
40 0.04
41 0.05
42 0.08
43 0.08
44 0.08
45 0.08
46 0.08
47 0.08
48 0.08
49 0.08
50 0.05
51 0.06
52 0.06
53 0.07
54 0.07
55 0.1
56 0.12
57 0.15
58 0.23
59 0.27
60 0.28
61 0.36
62 0.45
63 0.49
64 0.47
65 0.48
66 0.4
67 0.43
68 0.53
69 0.51
70 0.52
71 0.52
72 0.58
73 0.61
74 0.67
75 0.66
76 0.64
77 0.67
78 0.61
79 0.62
80 0.61
81 0.62
82 0.63
83 0.57