Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015KTH4

Protein Details
Accession A0A015KTH4    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
35-57ENEINKKDKKESKVKKMSKEGTIHydrophilic
180-200ASNNKLSRKNWRNCNQFFWKKHydrophilic
NLS Segment(s)
PositionSequence
40-50KKDKKESKVKK
Subcellular Location(s) nucl 24, mito_nucl 13.333, cyto_nucl 12.833
Family & Domain DBs
Amino Acid Sequences MEKAVESSIEEKDISKIWMVRNAKTIYKSGKRNVENEINKKDKKESKVKKMSKEGTIQSLTFTLREDNVPSPQTPLKRIYMGLSNMVTRKGRQIGSIITNDDGSPRKDEDVVKTIQRWRWREKQQRDTDSEKSDNKIGLASLGNLEAAPLKRDNVTPDEVVKIIKDMRAEQKIKCTPYQASNNKLSRKNWRNCNQFFWKKIMRWNGKGSMERLYNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.21
4 0.22
5 0.31
6 0.33
7 0.34
8 0.41
9 0.43
10 0.44
11 0.42
12 0.45
13 0.46
14 0.51
15 0.56
16 0.56
17 0.62
18 0.61
19 0.61
20 0.63
21 0.64
22 0.65
23 0.66
24 0.67
25 0.65
26 0.64
27 0.64
28 0.65
29 0.62
30 0.62
31 0.64
32 0.66
33 0.68
34 0.77
35 0.82
36 0.82
37 0.84
38 0.82
39 0.77
40 0.74
41 0.65
42 0.61
43 0.56
44 0.46
45 0.37
46 0.33
47 0.27
48 0.2
49 0.18
50 0.12
51 0.11
52 0.12
53 0.14
54 0.14
55 0.17
56 0.19
57 0.18
58 0.21
59 0.24
60 0.25
61 0.25
62 0.27
63 0.26
64 0.25
65 0.26
66 0.24
67 0.25
68 0.24
69 0.23
70 0.21
71 0.2
72 0.19
73 0.21
74 0.2
75 0.15
76 0.18
77 0.19
78 0.19
79 0.18
80 0.19
81 0.2
82 0.23
83 0.24
84 0.2
85 0.17
86 0.16
87 0.15
88 0.15
89 0.14
90 0.12
91 0.12
92 0.12
93 0.12
94 0.14
95 0.16
96 0.17
97 0.19
98 0.2
99 0.2
100 0.22
101 0.26
102 0.27
103 0.33
104 0.34
105 0.37
106 0.45
107 0.55
108 0.62
109 0.68
110 0.75
111 0.77
112 0.79
113 0.78
114 0.74
115 0.68
116 0.63
117 0.59
118 0.5
119 0.43
120 0.38
121 0.33
122 0.27
123 0.22
124 0.16
125 0.13
126 0.11
127 0.1
128 0.08
129 0.08
130 0.07
131 0.07
132 0.07
133 0.08
134 0.08
135 0.1
136 0.1
137 0.11
138 0.12
139 0.14
140 0.17
141 0.18
142 0.21
143 0.2
144 0.21
145 0.22
146 0.21
147 0.2
148 0.17
149 0.15
150 0.13
151 0.14
152 0.14
153 0.17
154 0.24
155 0.33
156 0.36
157 0.35
158 0.44
159 0.49
160 0.51
161 0.48
162 0.45
163 0.4
164 0.46
165 0.55
166 0.52
167 0.53
168 0.58
169 0.63
170 0.67
171 0.69
172 0.66
173 0.66
174 0.7
175 0.73
176 0.74
177 0.77
178 0.8
179 0.77
180 0.81
181 0.81
182 0.79
183 0.73
184 0.71
185 0.69
186 0.63
187 0.67
188 0.69
189 0.67
190 0.65
191 0.7
192 0.7
193 0.69
194 0.69
195 0.63
196 0.6