Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015IMV9

Protein Details
Accession A0A015IMV9    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
16-35AKTMVRKKKVKQIQRSVLNEHydrophilic
49-85ARLLKDTRSGKRRYKRRQEAYKRRNRRIRYKVEGQEKBasic
NLS Segment(s)
PositionSequence
55-79TRSGKRRYKRRQEAYKRRNRRIRYK
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MKEWEKLKFDAIKVLAKTMVRKKKVKQIQRSVLNEDFKEHHEVNAKCPARLLKDTRSGKRRYKRRQEAYKRRNRRIRYKVEGQEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.34
3 0.3
4 0.37
5 0.39
6 0.46
7 0.46
8 0.53
9 0.56
10 0.63
11 0.71
12 0.74
13 0.75
14 0.76
15 0.78
16 0.81
17 0.79
18 0.76
19 0.71
20 0.65
21 0.54
22 0.46
23 0.37
24 0.3
25 0.31
26 0.25
27 0.21
28 0.26
29 0.26
30 0.27
31 0.35
32 0.33
33 0.28
34 0.29
35 0.29
36 0.26
37 0.31
38 0.33
39 0.29
40 0.39
41 0.47
42 0.53
43 0.59
44 0.62
45 0.66
46 0.71
47 0.76
48 0.77
49 0.81
50 0.84
51 0.87
52 0.91
53 0.93
54 0.95
55 0.95
56 0.95
57 0.95
58 0.94
59 0.93
60 0.91
61 0.91
62 0.9
63 0.89
64 0.87
65 0.87