Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015MNK7

Protein Details
Accession A0A015MNK7    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
44-63KQSPKKPTGKKAHNINPMKRBasic
NLS Segment(s)
PositionSequence
48-55KKPTGKKA
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MEFRLSEKGLNDTVDVLENLKKSHNRNSIISKKSELKTYIYHIKQSPKKPTGKKAHNINPMKREEIKDPPSPSPMPKNESF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.13
4 0.14
5 0.14
6 0.14
7 0.18
8 0.22
9 0.25
10 0.34
11 0.41
12 0.42
13 0.46
14 0.55
15 0.59
16 0.58
17 0.56
18 0.5
19 0.49
20 0.47
21 0.46
22 0.38
23 0.32
24 0.3
25 0.33
26 0.38
27 0.32
28 0.34
29 0.33
30 0.4
31 0.44
32 0.49
33 0.54
34 0.52
35 0.6
36 0.63
37 0.7
38 0.72
39 0.74
40 0.75
41 0.76
42 0.78
43 0.8
44 0.82
45 0.79
46 0.76
47 0.7
48 0.67
49 0.61
50 0.55
51 0.51
52 0.52
53 0.51
54 0.51
55 0.52
56 0.5
57 0.52
58 0.51
59 0.51
60 0.51
61 0.52