Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015I4A5

Protein Details
Accession A0A015I4A5    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
4-36VVHPNLTKRHNRHTKSKKKSSTQEKKKGKIEEIBasic
NLS Segment(s)
PositionSequence
11-32KRHNRHTKSKKKSSTQEKKKGK
Subcellular Location(s) nucl 18, mito 6, cyto 3
Family & Domain DBs
Amino Acid Sequences MKRVVHPNLTKRHNRHTKSKKKSSTQEKKKGKIEEIPVQTTSDDDLDKYFAKQSRDLKFYDFPKDVDIYETLKKVGYVERLEVKWNYKYGTVRARI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.78
3 0.8
4 0.82
5 0.83
6 0.88
7 0.86
8 0.85
9 0.9
10 0.9
11 0.9
12 0.9
13 0.9
14 0.89
15 0.88
16 0.86
17 0.81
18 0.73
19 0.69
20 0.65
21 0.63
22 0.57
23 0.52
24 0.45
25 0.4
26 0.36
27 0.29
28 0.23
29 0.15
30 0.1
31 0.07
32 0.07
33 0.08
34 0.09
35 0.09
36 0.12
37 0.14
38 0.16
39 0.21
40 0.28
41 0.33
42 0.35
43 0.35
44 0.36
45 0.38
46 0.39
47 0.41
48 0.35
49 0.29
50 0.3
51 0.3
52 0.26
53 0.22
54 0.21
55 0.18
56 0.19
57 0.19
58 0.17
59 0.16
60 0.16
61 0.15
62 0.18
63 0.2
64 0.2
65 0.23
66 0.29
67 0.3
68 0.34
69 0.36
70 0.37
71 0.35
72 0.35
73 0.33
74 0.32
75 0.35
76 0.39