Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015M2G4

Protein Details
Accession A0A015M2G4    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
68-105LLITNKKTKTKNKKIYENQKHKENKREKNSKNKLKIGCHydrophilic
NLS Segment(s)
PositionSequence
73-101KKTKTKNKKIYENQKHKENKREKNSKNKL
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MTTTITTTATDTTEIAGKTLMKGTEDLTSKANADGADAIERTTEIYKKRKGESVEGDEEETRKGDENLLITNKKTKTKNKKIYENQKHKENKREKNSKNKLKIGCINVRGLNDTKKQGDIRKFLYSYCDFLYHCRCRSHENCVC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.14
4 0.13
5 0.13
6 0.17
7 0.16
8 0.13
9 0.14
10 0.15
11 0.2
12 0.21
13 0.22
14 0.2
15 0.2
16 0.2
17 0.19
18 0.19
19 0.13
20 0.12
21 0.11
22 0.11
23 0.11
24 0.11
25 0.1
26 0.09
27 0.09
28 0.09
29 0.1
30 0.13
31 0.17
32 0.24
33 0.31
34 0.35
35 0.38
36 0.42
37 0.43
38 0.47
39 0.49
40 0.49
41 0.47
42 0.43
43 0.42
44 0.37
45 0.34
46 0.27
47 0.2
48 0.13
49 0.09
50 0.09
51 0.08
52 0.09
53 0.09
54 0.11
55 0.15
56 0.15
57 0.15
58 0.2
59 0.22
60 0.27
61 0.32
62 0.39
63 0.47
64 0.58
65 0.68
66 0.7
67 0.79
68 0.83
69 0.88
70 0.89
71 0.89
72 0.83
73 0.82
74 0.83
75 0.78
76 0.78
77 0.77
78 0.76
79 0.76
80 0.81
81 0.79
82 0.81
83 0.87
84 0.87
85 0.85
86 0.83
87 0.77
88 0.74
89 0.74
90 0.7
91 0.67
92 0.59
93 0.54
94 0.49
95 0.45
96 0.41
97 0.37
98 0.35
99 0.32
100 0.34
101 0.32
102 0.34
103 0.38
104 0.42
105 0.47
106 0.47
107 0.48
108 0.51
109 0.5
110 0.45
111 0.48
112 0.43
113 0.38
114 0.34
115 0.33
116 0.26
117 0.31
118 0.41
119 0.41
120 0.43
121 0.45
122 0.45
123 0.51
124 0.55