Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015KKR2

Protein Details
Accession A0A015KKR2   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
22-46VLYYRNRRRIDREKKKPPEPKDKLTBasic
NLS Segment(s)
PositionSequence
28-42RRRIDREKKKPPEPK
Subcellular Location(s) nucl 10, E.R. 7, cyto 3, golg 2, vacu 2, cyto_mito 2, cyto_pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MFFGINSDFIKIVAALALVGTVLYYRNRRRIDREKKKPPEPKDKLTETNESTIIDTSSKEKEEIPLIQDSSNVDIPNESEENSKWVIVDFDDEQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.05
3 0.05
4 0.04
5 0.03
6 0.03
7 0.03
8 0.03
9 0.04
10 0.08
11 0.15
12 0.2
13 0.29
14 0.35
15 0.39
16 0.48
17 0.58
18 0.66
19 0.7
20 0.76
21 0.79
22 0.83
23 0.89
24 0.89
25 0.87
26 0.87
27 0.82
28 0.79
29 0.75
30 0.71
31 0.67
32 0.62
33 0.59
34 0.49
35 0.43
36 0.37
37 0.3
38 0.25
39 0.19
40 0.15
41 0.1
42 0.09
43 0.1
44 0.11
45 0.11
46 0.12
47 0.12
48 0.13
49 0.16
50 0.17
51 0.18
52 0.19
53 0.19
54 0.19
55 0.19
56 0.18
57 0.19
58 0.19
59 0.17
60 0.13
61 0.13
62 0.13
63 0.17
64 0.17
65 0.14
66 0.14
67 0.14
68 0.18
69 0.19
70 0.18
71 0.14
72 0.14
73 0.14
74 0.12
75 0.16