Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3K3T5

Protein Details
Accession J3K3T5    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
28-49AGDRRDGERKRERRRPGLQAGFBasic
NLS Segment(s)
PositionSequence
33-43DGERKRERRRP
Subcellular Location(s) nucl 7.5, cyto_nucl 7.5, mito 7, cyto 6.5, extr 4
Family & Domain DBs
KEGG cim:CIMG_13321  -  
Amino Acid Sequences MSVPLPAGGAAVESVRSAGVERAIAFSAGDRRDGERKRERRRPGLQAGFTTRPEEEARLVSVQGSPVEFLAWGWPHLQANKRQALRSGWLAAGNLNFPRSVARFRLLSFFNHPSSTTNRTTLPNQPAHPSDTQPADTRIMLGC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.07
5 0.07
6 0.08
7 0.09
8 0.1
9 0.12
10 0.12
11 0.12
12 0.11
13 0.12
14 0.17
15 0.16
16 0.17
17 0.16
18 0.2
19 0.28
20 0.33
21 0.4
22 0.45
23 0.54
24 0.63
25 0.71
26 0.76
27 0.78
28 0.82
29 0.82
30 0.81
31 0.8
32 0.72
33 0.67
34 0.65
35 0.58
36 0.51
37 0.43
38 0.33
39 0.27
40 0.25
41 0.22
42 0.16
43 0.14
44 0.15
45 0.13
46 0.13
47 0.11
48 0.1
49 0.1
50 0.09
51 0.08
52 0.06
53 0.06
54 0.06
55 0.05
56 0.05
57 0.06
58 0.06
59 0.06
60 0.07
61 0.08
62 0.08
63 0.12
64 0.15
65 0.19
66 0.25
67 0.31
68 0.33
69 0.33
70 0.35
71 0.34
72 0.34
73 0.31
74 0.26
75 0.2
76 0.19
77 0.18
78 0.16
79 0.15
80 0.13
81 0.11
82 0.1
83 0.09
84 0.08
85 0.11
86 0.12
87 0.15
88 0.16
89 0.18
90 0.19
91 0.21
92 0.26
93 0.24
94 0.26
95 0.29
96 0.31
97 0.3
98 0.3
99 0.29
100 0.27
101 0.32
102 0.34
103 0.31
104 0.29
105 0.3
106 0.33
107 0.36
108 0.42
109 0.45
110 0.45
111 0.44
112 0.47
113 0.47
114 0.48
115 0.46
116 0.41
117 0.38
118 0.36
119 0.37
120 0.34
121 0.35
122 0.33
123 0.31