Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015LJR1

Protein Details
Accession A0A015LJR1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
401-428IHRELRDEEKCKKKYKKDWDRYCEIVKYBasic
NLS Segment(s)
Subcellular Location(s) plas 15, E.R. 6, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001171  ERG24_DHCR-like  
IPR018083  Sterol_reductase_CS  
Gene Ontology GO:0016020  C:membrane  
GO:0016628  F:oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor  
GO:0016126  P:sterol biosynthetic process  
Pfam View protein in Pfam  
PF01222  ERG4_ERG24  
PROSITE View protein in PROSITE  
PS01017  STEROL_REDUCT_1  
PS01018  STEROL_REDUCT_2  
Amino Acid Sequences MLSKKPLHNPKTTEYEFLGPIGAFLMITVLPSLVYLLHLGCQPEGCPSPALVKQLLNPQQLAQFFSTENILSLFDLQSFIAYVGYLSYLVLAWYLVPGRWVEGTQLRDGSKLKYKENGFRSMMLTLSIIGCTILFKGYEPLLFIYDHFIGLMTCSIIVSFSVAIYVYLASFQEGKLLALGGNSGNIIYDFMIGRELNPRIGSFDIKYFVELRPGITEWTIINIAMAAKQYHDLGYITIGMILVIIFQGWYCIDSVYNEPAVLTTMDITTDGFGWMLSFGNITWLGFLYPLQARYLALKPNHLSWLEIAIIVSLQTIGYTIFRGANNEKNAFRNNPDDPKLKDLKYMTTESGSKLIISSWWGKARHINYLGDWIMSWAWCLPCGFNDIFPYFYVIYFAVLLIHRELRDEEKCKKKYKKDWDRYCEIVKYKIIPGIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.51
3 0.43
4 0.38
5 0.33
6 0.22
7 0.2
8 0.16
9 0.12
10 0.08
11 0.07
12 0.08
13 0.05
14 0.06
15 0.06
16 0.05
17 0.05
18 0.05
19 0.06
20 0.05
21 0.06
22 0.06
23 0.07
24 0.08
25 0.11
26 0.12
27 0.12
28 0.13
29 0.12
30 0.17
31 0.19
32 0.19
33 0.18
34 0.17
35 0.23
36 0.25
37 0.28
38 0.25
39 0.25
40 0.27
41 0.36
42 0.43
43 0.4
44 0.38
45 0.36
46 0.38
47 0.37
48 0.37
49 0.28
50 0.22
51 0.19
52 0.2
53 0.19
54 0.15
55 0.14
56 0.12
57 0.11
58 0.1
59 0.11
60 0.1
61 0.09
62 0.1
63 0.09
64 0.08
65 0.08
66 0.08
67 0.06
68 0.06
69 0.05
70 0.05
71 0.05
72 0.05
73 0.05
74 0.05
75 0.05
76 0.05
77 0.05
78 0.04
79 0.04
80 0.05
81 0.06
82 0.06
83 0.07
84 0.07
85 0.08
86 0.09
87 0.1
88 0.12
89 0.17
90 0.19
91 0.21
92 0.24
93 0.23
94 0.25
95 0.27
96 0.28
97 0.31
98 0.32
99 0.33
100 0.37
101 0.41
102 0.47
103 0.51
104 0.54
105 0.47
106 0.46
107 0.45
108 0.38
109 0.33
110 0.25
111 0.2
112 0.13
113 0.11
114 0.09
115 0.07
116 0.06
117 0.05
118 0.05
119 0.05
120 0.05
121 0.05
122 0.06
123 0.08
124 0.09
125 0.09
126 0.1
127 0.1
128 0.11
129 0.11
130 0.11
131 0.12
132 0.12
133 0.11
134 0.1
135 0.09
136 0.08
137 0.08
138 0.08
139 0.04
140 0.04
141 0.04
142 0.04
143 0.04
144 0.04
145 0.04
146 0.04
147 0.04
148 0.04
149 0.04
150 0.04
151 0.04
152 0.04
153 0.04
154 0.04
155 0.04
156 0.05
157 0.05
158 0.05
159 0.07
160 0.07
161 0.07
162 0.07
163 0.07
164 0.07
165 0.06
166 0.07
167 0.05
168 0.05
169 0.04
170 0.04
171 0.04
172 0.04
173 0.04
174 0.04
175 0.05
176 0.04
177 0.05
178 0.07
179 0.06
180 0.07
181 0.11
182 0.12
183 0.12
184 0.12
185 0.12
186 0.12
187 0.14
188 0.15
189 0.11
190 0.12
191 0.13
192 0.13
193 0.14
194 0.13
195 0.13
196 0.15
197 0.14
198 0.13
199 0.13
200 0.13
201 0.13
202 0.11
203 0.12
204 0.08
205 0.09
206 0.09
207 0.07
208 0.06
209 0.06
210 0.06
211 0.06
212 0.07
213 0.05
214 0.05
215 0.06
216 0.06
217 0.06
218 0.07
219 0.06
220 0.06
221 0.06
222 0.06
223 0.06
224 0.06
225 0.05
226 0.04
227 0.04
228 0.03
229 0.03
230 0.02
231 0.02
232 0.02
233 0.02
234 0.03
235 0.03
236 0.03
237 0.04
238 0.04
239 0.04
240 0.06
241 0.08
242 0.1
243 0.1
244 0.09
245 0.09
246 0.09
247 0.1
248 0.08
249 0.07
250 0.05
251 0.05
252 0.05
253 0.05
254 0.05
255 0.05
256 0.05
257 0.05
258 0.04
259 0.04
260 0.04
261 0.05
262 0.05
263 0.04
264 0.04
265 0.04
266 0.06
267 0.07
268 0.06
269 0.06
270 0.06
271 0.06
272 0.06
273 0.06
274 0.07
275 0.09
276 0.1
277 0.1
278 0.11
279 0.11
280 0.15
281 0.18
282 0.21
283 0.2
284 0.25
285 0.25
286 0.28
287 0.31
288 0.27
289 0.25
290 0.2
291 0.21
292 0.17
293 0.15
294 0.13
295 0.09
296 0.08
297 0.08
298 0.07
299 0.04
300 0.03
301 0.03
302 0.03
303 0.04
304 0.04
305 0.05
306 0.06
307 0.09
308 0.1
309 0.15
310 0.18
311 0.25
312 0.3
313 0.34
314 0.35
315 0.36
316 0.4
317 0.39
318 0.39
319 0.38
320 0.39
321 0.43
322 0.46
323 0.48
324 0.46
325 0.51
326 0.54
327 0.48
328 0.49
329 0.43
330 0.43
331 0.43
332 0.43
333 0.37
334 0.34
335 0.35
336 0.3
337 0.31
338 0.25
339 0.2
340 0.16
341 0.15
342 0.12
343 0.14
344 0.17
345 0.19
346 0.26
347 0.27
348 0.28
349 0.36
350 0.37
351 0.43
352 0.43
353 0.39
354 0.34
355 0.4
356 0.39
357 0.31
358 0.28
359 0.21
360 0.17
361 0.15
362 0.15
363 0.11
364 0.11
365 0.12
366 0.13
367 0.12
368 0.13
369 0.18
370 0.18
371 0.17
372 0.22
373 0.22
374 0.23
375 0.22
376 0.25
377 0.21
378 0.2
379 0.2
380 0.15
381 0.14
382 0.13
383 0.13
384 0.11
385 0.11
386 0.13
387 0.14
388 0.17
389 0.16
390 0.18
391 0.2
392 0.24
393 0.32
394 0.37
395 0.44
396 0.51
397 0.59
398 0.67
399 0.75
400 0.79
401 0.82
402 0.87
403 0.88
404 0.89
405 0.93
406 0.92
407 0.89
408 0.85
409 0.81
410 0.78
411 0.71
412 0.66
413 0.59
414 0.55
415 0.5