Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015JE05

Protein Details
Accession A0A015JE05   
Localization Confidence High
Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MPVREPKRKKQSISKKNKESKEQANSKHydrophilic
NLS Segment(s)
PositionSequence
6-18PKRKKQSISKKNK
Subcellular Location(s) nucl 26
Family & Domain DBs
Amino Acid Sequences MPVREPKRKKQSISKKNKESKEQANSKMDEVDVFFQSPSQTECNDDDNSRKMNVYDYEKYEKSYAKLDDSNKWVLTTAHITAPVTCMSGNICYSVKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.89
3 0.9
4 0.89
5 0.87
6 0.84
7 0.83
8 0.82
9 0.79
10 0.76
11 0.73
12 0.67
13 0.59
14 0.51
15 0.41
16 0.31
17 0.25
18 0.19
19 0.14
20 0.13
21 0.11
22 0.11
23 0.11
24 0.11
25 0.11
26 0.1
27 0.1
28 0.12
29 0.14
30 0.17
31 0.18
32 0.18
33 0.19
34 0.2
35 0.21
36 0.19
37 0.17
38 0.14
39 0.15
40 0.18
41 0.22
42 0.23
43 0.26
44 0.31
45 0.31
46 0.33
47 0.33
48 0.3
49 0.26
50 0.28
51 0.25
52 0.24
53 0.29
54 0.3
55 0.34
56 0.36
57 0.39
58 0.34
59 0.32
60 0.29
61 0.24
62 0.24
63 0.22
64 0.19
65 0.17
66 0.18
67 0.18
68 0.17
69 0.19
70 0.16
71 0.13
72 0.11
73 0.1
74 0.11
75 0.13
76 0.14
77 0.15