Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015MZF2

Protein Details
Accession A0A015MZF2    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
256-276EIVIWEKTVQRRKPSRFYKRNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 10.166, nucl 10, mito 10, cyto_nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021139  NYN  
Gene Ontology GO:0004540  F:RNA nuclease activity  
Pfam View protein in Pfam  
PF01936  NYN  
Amino Acid Sequences MEGGYFIRSQKPGCFLSSNNKIIFDYGLLFKKIRGNRELGGNPIIVGSEISPNDSIYNQGYDVKVFKRNCKGKEEGVDNFITLKMTTTFCDEKRPSTLILIAGDGDYFETLLEAIKRKWKVEVWFWSGILNCFNNHEPTKLCKKHLFPIIVSDDLKLSFPTTGTSDKIKYEAKIHYTQLETCYKFFIYINGNPYNGMESLEITSCTMIENREIMEWLAKLNLFSWINRENDSIFLYFNNKAELKTAKEWIMKEHKEIVIWEKTVQRRKPSRFYKRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.33
3 0.41
4 0.48
5 0.5
6 0.45
7 0.45
8 0.41
9 0.38
10 0.36
11 0.27
12 0.2
13 0.2
14 0.22
15 0.23
16 0.23
17 0.24
18 0.32
19 0.35
20 0.38
21 0.37
22 0.38
23 0.38
24 0.47
25 0.47
26 0.43
27 0.4
28 0.34
29 0.3
30 0.25
31 0.22
32 0.13
33 0.11
34 0.08
35 0.1
36 0.1
37 0.12
38 0.12
39 0.13
40 0.14
41 0.13
42 0.14
43 0.12
44 0.13
45 0.12
46 0.14
47 0.14
48 0.15
49 0.18
50 0.19
51 0.26
52 0.27
53 0.34
54 0.42
55 0.49
56 0.52
57 0.55
58 0.57
59 0.55
60 0.6
61 0.58
62 0.5
63 0.46
64 0.42
65 0.35
66 0.31
67 0.25
68 0.18
69 0.12
70 0.11
71 0.09
72 0.1
73 0.1
74 0.15
75 0.19
76 0.19
77 0.28
78 0.28
79 0.29
80 0.32
81 0.33
82 0.28
83 0.26
84 0.27
85 0.2
86 0.19
87 0.16
88 0.12
89 0.11
90 0.09
91 0.08
92 0.06
93 0.04
94 0.04
95 0.03
96 0.03
97 0.03
98 0.04
99 0.05
100 0.07
101 0.08
102 0.15
103 0.16
104 0.17
105 0.2
106 0.23
107 0.26
108 0.32
109 0.39
110 0.38
111 0.38
112 0.38
113 0.36
114 0.33
115 0.29
116 0.23
117 0.16
118 0.11
119 0.12
120 0.13
121 0.15
122 0.15
123 0.16
124 0.15
125 0.2
126 0.3
127 0.31
128 0.34
129 0.36
130 0.38
131 0.43
132 0.48
133 0.45
134 0.35
135 0.38
136 0.37
137 0.34
138 0.31
139 0.25
140 0.19
141 0.17
142 0.17
143 0.11
144 0.08
145 0.06
146 0.06
147 0.07
148 0.09
149 0.11
150 0.12
151 0.14
152 0.15
153 0.16
154 0.19
155 0.2
156 0.19
157 0.22
158 0.24
159 0.27
160 0.29
161 0.3
162 0.3
163 0.3
164 0.3
165 0.3
166 0.33
167 0.29
168 0.25
169 0.26
170 0.22
171 0.22
172 0.21
173 0.2
174 0.18
175 0.21
176 0.26
177 0.26
178 0.27
179 0.26
180 0.26
181 0.24
182 0.18
183 0.16
184 0.1
185 0.09
186 0.11
187 0.11
188 0.11
189 0.09
190 0.09
191 0.07
192 0.08
193 0.08
194 0.07
195 0.08
196 0.09
197 0.1
198 0.1
199 0.11
200 0.1
201 0.12
202 0.11
203 0.1
204 0.11
205 0.1
206 0.1
207 0.1
208 0.16
209 0.15
210 0.15
211 0.2
212 0.23
213 0.25
214 0.27
215 0.28
216 0.22
217 0.23
218 0.25
219 0.2
220 0.16
221 0.16
222 0.18
223 0.19
224 0.19
225 0.22
226 0.2
227 0.2
228 0.23
229 0.26
230 0.29
231 0.31
232 0.35
233 0.36
234 0.4
235 0.4
236 0.45
237 0.51
238 0.47
239 0.47
240 0.5
241 0.45
242 0.42
243 0.44
244 0.42
245 0.38
246 0.37
247 0.36
248 0.37
249 0.44
250 0.52
251 0.57
252 0.61
253 0.64
254 0.72
255 0.79
256 0.82