Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015L8T9

Protein Details
Accession A0A015L8T9   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
65-91NIYENKGKYKRIRIKNDDKSWKKVYKRHydrophilic
NLS Segment(s)
PositionSequence
72-91KYKRIRIKNDDKSWKKVYKR
Subcellular Location(s) nucl 19.5, cyto_nucl 12, cyto 3.5, mito 3
Family & Domain DBs
Amino Acid Sequences MEKEIFKYKDIIDNAVIIFLENKECWNNYIGRETKKSNEGHKTSYETLNEEEYMDMVKMFKEHQNIYENKGKYKRIRIKNDDKSWKKVYKRVEKLLEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.23
3 0.21
4 0.13
5 0.12
6 0.1
7 0.11
8 0.09
9 0.11
10 0.12
11 0.13
12 0.14
13 0.16
14 0.17
15 0.17
16 0.25
17 0.28
18 0.31
19 0.35
20 0.36
21 0.37
22 0.42
23 0.43
24 0.42
25 0.47
26 0.45
27 0.44
28 0.44
29 0.45
30 0.41
31 0.4
32 0.34
33 0.26
34 0.25
35 0.22
36 0.2
37 0.15
38 0.12
39 0.09
40 0.08
41 0.07
42 0.06
43 0.05
44 0.04
45 0.05
46 0.07
47 0.1
48 0.13
49 0.15
50 0.19
51 0.26
52 0.27
53 0.32
54 0.38
55 0.36
56 0.39
57 0.44
58 0.47
59 0.47
60 0.57
61 0.61
62 0.64
63 0.74
64 0.77
65 0.82
66 0.86
67 0.9
68 0.9
69 0.86
70 0.83
71 0.82
72 0.8
73 0.76
74 0.71
75 0.72
76 0.72
77 0.75
78 0.77