Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015NB26

Protein Details
Accession A0A015NB26   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
142-176FEHDKKLQRLRRDDKKHMRKRNKKNSEYKNLKFDLBasic
NLS Segment(s)
PositionSequence
129-166KLKSELIKKEKELFEHDKKLQRLRRDDKKHMRKRNKKN
Subcellular Location(s) nucl 24.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MTYQKVKEKVNEIRKLKSELTKIEEELSEHNKVANENFEKLQRLRTEEDDKKYKSKIYDEAEKWDKKNSERENLKLEQEESIDSLIKYATRKRDYWNDVINLHSINRDFDKPLSKMPQKIKETINEIRKLKSELIKKEKELFEHDKKLQRLRRDDKKHMRKRNKKNSEYKNLKFDLEKLIEFLIICEMQKRDYWKYVILHAKNRNFDEPLSKIKNRST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.69
3 0.65
4 0.62
5 0.59
6 0.55
7 0.57
8 0.53
9 0.49
10 0.46
11 0.41
12 0.34
13 0.33
14 0.32
15 0.28
16 0.24
17 0.25
18 0.23
19 0.24
20 0.24
21 0.27
22 0.25
23 0.26
24 0.28
25 0.29
26 0.33
27 0.33
28 0.38
29 0.32
30 0.34
31 0.35
32 0.39
33 0.46
34 0.48
35 0.55
36 0.56
37 0.57
38 0.56
39 0.55
40 0.53
41 0.47
42 0.45
43 0.46
44 0.43
45 0.5
46 0.47
47 0.53
48 0.57
49 0.57
50 0.53
51 0.51
52 0.49
53 0.43
54 0.51
55 0.48
56 0.5
57 0.51
58 0.54
59 0.54
60 0.53
61 0.51
62 0.43
63 0.38
64 0.29
65 0.24
66 0.21
67 0.15
68 0.13
69 0.12
70 0.09
71 0.09
72 0.08
73 0.08
74 0.1
75 0.14
76 0.22
77 0.25
78 0.26
79 0.31
80 0.4
81 0.44
82 0.48
83 0.48
84 0.43
85 0.4
86 0.39
87 0.35
88 0.26
89 0.21
90 0.16
91 0.11
92 0.1
93 0.11
94 0.11
95 0.11
96 0.13
97 0.18
98 0.17
99 0.21
100 0.27
101 0.28
102 0.34
103 0.4
104 0.48
105 0.46
106 0.5
107 0.48
108 0.44
109 0.48
110 0.49
111 0.49
112 0.46
113 0.44
114 0.41
115 0.4
116 0.39
117 0.36
118 0.35
119 0.36
120 0.38
121 0.46
122 0.48
123 0.49
124 0.54
125 0.52
126 0.48
127 0.48
128 0.47
129 0.46
130 0.49
131 0.52
132 0.52
133 0.54
134 0.6
135 0.58
136 0.58
137 0.61
138 0.64
139 0.69
140 0.71
141 0.79
142 0.81
143 0.87
144 0.89
145 0.9
146 0.92
147 0.92
148 0.94
149 0.94
150 0.94
151 0.93
152 0.93
153 0.93
154 0.92
155 0.92
156 0.86
157 0.83
158 0.74
159 0.66
160 0.57
161 0.49
162 0.46
163 0.39
164 0.34
165 0.26
166 0.25
167 0.23
168 0.21
169 0.19
170 0.14
171 0.11
172 0.11
173 0.14
174 0.14
175 0.15
176 0.18
177 0.24
178 0.26
179 0.31
180 0.34
181 0.36
182 0.38
183 0.45
184 0.52
185 0.52
186 0.56
187 0.6
188 0.64
189 0.65
190 0.68
191 0.64
192 0.56
193 0.52
194 0.5
195 0.45
196 0.48
197 0.49
198 0.48