Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015NI06

Protein Details
Accession A0A015NI06    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
11-35ESDNNKPNFRTKRNRLLVKKANFNPHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 9.5cyto_nucl 9.5, nucl 8.5, mito 5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009003  Peptidase_S1_PA  
IPR043504  Peptidase_S1_PA_chymotrypsin  
Amino Acid Sequences MRDAIPLTNNESDNNKPNFRTKRNRLLVKKANFNPYVPYGKLFFHNTGDGKNYACTASVIRTDNGNIGLTAAHCIYNQNNNWSSNMVFCPGFQNGECPVAIPVKGGSVEVVNNKYYYDYGMIKFNYDQGKLQDRTGCFELVMTVSTINM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.41
3 0.39
4 0.48
5 0.55
6 0.61
7 0.67
8 0.67
9 0.72
10 0.79
11 0.86
12 0.84
13 0.85
14 0.86
15 0.82
16 0.83
17 0.78
18 0.76
19 0.68
20 0.6
21 0.54
22 0.49
23 0.47
24 0.37
25 0.33
26 0.26
27 0.26
28 0.29
29 0.28
30 0.24
31 0.22
32 0.25
33 0.24
34 0.24
35 0.25
36 0.22
37 0.19
38 0.18
39 0.16
40 0.12
41 0.12
42 0.11
43 0.09
44 0.1
45 0.13
46 0.15
47 0.14
48 0.15
49 0.15
50 0.15
51 0.15
52 0.13
53 0.09
54 0.07
55 0.07
56 0.07
57 0.07
58 0.06
59 0.06
60 0.05
61 0.07
62 0.08
63 0.13
64 0.14
65 0.18
66 0.2
67 0.21
68 0.22
69 0.22
70 0.21
71 0.17
72 0.16
73 0.13
74 0.11
75 0.1
76 0.12
77 0.12
78 0.13
79 0.11
80 0.13
81 0.12
82 0.14
83 0.14
84 0.11
85 0.12
86 0.12
87 0.12
88 0.1
89 0.09
90 0.08
91 0.09
92 0.08
93 0.07
94 0.07
95 0.09
96 0.13
97 0.15
98 0.15
99 0.15
100 0.15
101 0.15
102 0.14
103 0.14
104 0.14
105 0.15
106 0.15
107 0.21
108 0.21
109 0.22
110 0.23
111 0.26
112 0.27
113 0.25
114 0.27
115 0.27
116 0.36
117 0.35
118 0.39
119 0.39
120 0.36
121 0.41
122 0.41
123 0.36
124 0.26
125 0.25
126 0.23
127 0.18
128 0.17
129 0.12