Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015J6D4

Protein Details
Accession A0A015J6D4    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
48-69TGSTEPKKRSRRPKVLTERDTRBasic
NLS Segment(s)
PositionSequence
53-62PKKRSRRPKV
Subcellular Location(s) mito 14.5, mito_nucl 13.499, nucl 11, cyto_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR036388  WH-like_DNA-bd_sf  
Pfam View protein in Pfam  
PF13518  HTH_28  
Amino Acid Sequences MRGKEVSKTHRKRIIGAYLSGIRQRVISTQFGIPTSTVNDIIKKYKETGSTEPKKRSRRPKVLTERDTRALKRIIRTRDWNRFCNSRINRKSFLNRLIENRIKKSNLTPKQFFHSYDLLWS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.61
3 0.55
4 0.51
5 0.46
6 0.46
7 0.43
8 0.35
9 0.25
10 0.21
11 0.2
12 0.19
13 0.19
14 0.19
15 0.19
16 0.21
17 0.22
18 0.22
19 0.22
20 0.18
21 0.16
22 0.15
23 0.14
24 0.14
25 0.13
26 0.15
27 0.16
28 0.2
29 0.21
30 0.21
31 0.21
32 0.23
33 0.27
34 0.3
35 0.35
36 0.41
37 0.49
38 0.54
39 0.6
40 0.65
41 0.69
42 0.73
43 0.77
44 0.77
45 0.78
46 0.77
47 0.79
48 0.82
49 0.84
50 0.83
51 0.78
52 0.71
53 0.67
54 0.65
55 0.54
56 0.48
57 0.43
58 0.38
59 0.39
60 0.42
61 0.41
62 0.44
63 0.53
64 0.58
65 0.63
66 0.66
67 0.63
68 0.61
69 0.6
70 0.56
71 0.57
72 0.56
73 0.56
74 0.59
75 0.61
76 0.6
77 0.62
78 0.68
79 0.65
80 0.65
81 0.61
82 0.57
83 0.56
84 0.61
85 0.62
86 0.6
87 0.58
88 0.57
89 0.52
90 0.5
91 0.54
92 0.56
93 0.57
94 0.61
95 0.61
96 0.58
97 0.64
98 0.66
99 0.59
100 0.53
101 0.48