Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3K2I5

Protein Details
Accession J3K2I5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
4-49AKKHVAIVKKHPKRFNRHQSDMFKCVPTSWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
34-51RKPKGIDNRVRRRFKGQA
Subcellular Location(s) mito 17, cyto 7, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cim:CIMG_09506  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVAAKKHVAIVKKHPKRFNRHQSDMFKCVPTSWRKPKGIDNRVRRRFKGQAAMPKIGYGSNKKTRHMIPSGHKVFLVKNPKDVELLLMHNRTYAAEIAHAVSSSKRVDIIAKAKQLGVKITNPKGRVTTES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.76
3 0.8
4 0.85
5 0.86
6 0.85
7 0.84
8 0.84
9 0.85
10 0.83
11 0.79
12 0.71
13 0.62
14 0.51
15 0.44
16 0.42
17 0.4
18 0.43
19 0.48
20 0.54
21 0.56
22 0.59
23 0.67
24 0.71
25 0.73
26 0.73
27 0.73
28 0.75
29 0.81
30 0.84
31 0.77
32 0.73
33 0.69
34 0.65
35 0.63
36 0.58
37 0.58
38 0.57
39 0.57
40 0.5
41 0.43
42 0.38
43 0.3
44 0.27
45 0.22
46 0.24
47 0.31
48 0.33
49 0.34
50 0.37
51 0.38
52 0.41
53 0.4
54 0.39
55 0.36
56 0.44
57 0.45
58 0.42
59 0.4
60 0.35
61 0.32
62 0.34
63 0.37
64 0.27
65 0.3
66 0.31
67 0.32
68 0.32
69 0.31
70 0.25
71 0.18
72 0.21
73 0.19
74 0.19
75 0.18
76 0.18
77 0.18
78 0.16
79 0.15
80 0.12
81 0.08
82 0.08
83 0.09
84 0.1
85 0.1
86 0.1
87 0.09
88 0.08
89 0.11
90 0.11
91 0.11
92 0.1
93 0.11
94 0.13
95 0.2
96 0.27
97 0.3
98 0.34
99 0.34
100 0.36
101 0.37
102 0.36
103 0.34
104 0.31
105 0.32
106 0.37
107 0.45
108 0.5
109 0.49
110 0.51
111 0.49