Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015KCG4

Protein Details
Accession A0A015KCG4    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
168-195VVESQVGKKREKHCKKCNQSDHYASQCPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MSYSTNAQFHISLISHHWYNNNKYNIEQRKKNIVLFHNEENILADESEQPSFQHLMNFRQTPNVVQLQDPKQKYGFGMGYAKKALDLAVQTDKIDEFVGQVKYFIENTKAELSKQQENLTSMHIGDPLRVQHKGRQPNRYKSCGEPQRKKSKYIRNIINITNKNYEEVVESQVGKKREKHCKKCNQSDHYASQCPNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.22
4 0.28
5 0.31
6 0.38
7 0.45
8 0.48
9 0.44
10 0.46
11 0.55
12 0.6
13 0.62
14 0.62
15 0.6
16 0.64
17 0.67
18 0.67
19 0.64
20 0.59
21 0.59
22 0.56
23 0.54
24 0.48
25 0.45
26 0.41
27 0.35
28 0.31
29 0.23
30 0.18
31 0.14
32 0.12
33 0.13
34 0.14
35 0.12
36 0.11
37 0.12
38 0.14
39 0.13
40 0.16
41 0.17
42 0.21
43 0.27
44 0.29
45 0.27
46 0.3
47 0.3
48 0.27
49 0.29
50 0.29
51 0.23
52 0.23
53 0.29
54 0.32
55 0.4
56 0.39
57 0.36
58 0.32
59 0.32
60 0.31
61 0.29
62 0.22
63 0.17
64 0.23
65 0.22
66 0.24
67 0.23
68 0.23
69 0.18
70 0.17
71 0.15
72 0.09
73 0.08
74 0.09
75 0.11
76 0.12
77 0.12
78 0.12
79 0.11
80 0.11
81 0.1
82 0.07
83 0.05
84 0.09
85 0.1
86 0.1
87 0.1
88 0.1
89 0.11
90 0.11
91 0.11
92 0.1
93 0.09
94 0.12
95 0.16
96 0.16
97 0.16
98 0.2
99 0.23
100 0.26
101 0.28
102 0.27
103 0.25
104 0.26
105 0.27
106 0.24
107 0.21
108 0.16
109 0.14
110 0.15
111 0.12
112 0.11
113 0.12
114 0.13
115 0.15
116 0.17
117 0.18
118 0.23
119 0.31
120 0.41
121 0.46
122 0.54
123 0.6
124 0.69
125 0.75
126 0.74
127 0.69
128 0.64
129 0.68
130 0.67
131 0.69
132 0.68
133 0.71
134 0.77
135 0.76
136 0.78
137 0.77
138 0.78
139 0.77
140 0.77
141 0.76
142 0.74
143 0.76
144 0.75
145 0.76
146 0.69
147 0.64
148 0.6
149 0.51
150 0.44
151 0.39
152 0.33
153 0.27
154 0.24
155 0.23
156 0.2
157 0.2
158 0.23
159 0.28
160 0.31
161 0.31
162 0.37
163 0.43
164 0.52
165 0.62
166 0.69
167 0.75
168 0.83
169 0.9
170 0.93
171 0.94
172 0.91
173 0.89
174 0.86
175 0.84
176 0.8
177 0.76