Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015NDC2

Protein Details
Accession A0A015NDC2    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
35-62EEKHPNTQKKTKNSLKKKSNNKDNKAVLHydrophilic
NLS Segment(s)
PositionSequence
42-52QKKTKNSLKKK
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MKKSGKSDNNLDRNQPKKKDNSISSKKVSKSNNQEEKHPNTQKKTKNSLKKKSNNKDNKAVLAEILTLLQKLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.7
3 0.66
4 0.65
5 0.71
6 0.72
7 0.72
8 0.74
9 0.74
10 0.74
11 0.74
12 0.72
13 0.66
14 0.63
15 0.59
16 0.57
17 0.58
18 0.61
19 0.65
20 0.59
21 0.64
22 0.63
23 0.66
24 0.66
25 0.64
26 0.58
27 0.55
28 0.62
29 0.63
30 0.65
31 0.68
32 0.68
33 0.71
34 0.77
35 0.81
36 0.83
37 0.85
38 0.88
39 0.89
40 0.9
41 0.9
42 0.87
43 0.86
44 0.8
45 0.76
46 0.68
47 0.57
48 0.47
49 0.37
50 0.31
51 0.21
52 0.18
53 0.12