Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D8JUB6

Protein Details
Accession A0A0D8JUB6    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
84-109DSARSNHSRRAGRRRTRKTMLKEVASHydrophilic
NLS Segment(s)
PositionSequence
92-101RRAGRRRTRK
Subcellular Location(s) mito 15, cyto_nucl 5, nucl 4.5, cyto 4.5
Family & Domain DBs
KEGG cim:CIMG_11729  -  
Amino Acid Sequences MCVWTQKTRLPSAVCAPMIWKDSTPAMLINQIWQISTACFVAQRDSKRCPGDSRPFSPKGHAECFFVSGCCSSEDLPSNWDDGDSARSNHSRRAGRRRTRKTMLKEVASLCM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.36
3 0.34
4 0.32
5 0.32
6 0.29
7 0.23
8 0.18
9 0.19
10 0.2
11 0.19
12 0.15
13 0.13
14 0.15
15 0.15
16 0.15
17 0.16
18 0.14
19 0.14
20 0.13
21 0.13
22 0.1
23 0.11
24 0.09
25 0.07
26 0.08
27 0.08
28 0.12
29 0.16
30 0.21
31 0.25
32 0.28
33 0.34
34 0.36
35 0.37
36 0.38
37 0.41
38 0.46
39 0.48
40 0.49
41 0.5
42 0.52
43 0.51
44 0.49
45 0.45
46 0.4
47 0.38
48 0.34
49 0.3
50 0.26
51 0.28
52 0.25
53 0.2
54 0.16
55 0.12
56 0.12
57 0.1
58 0.11
59 0.09
60 0.12
61 0.15
62 0.15
63 0.15
64 0.15
65 0.15
66 0.14
67 0.13
68 0.11
69 0.09
70 0.13
71 0.14
72 0.14
73 0.18
74 0.23
75 0.25
76 0.3
77 0.37
78 0.4
79 0.47
80 0.58
81 0.64
82 0.7
83 0.8
84 0.84
85 0.86
86 0.88
87 0.89
88 0.87
89 0.87
90 0.85
91 0.79
92 0.74