Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015JBX5

Protein Details
Accession A0A015JBX5    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
33-54EYLVKKSSVKRKRGTRVSKSAVHydrophilic
NLS Segment(s)
PositionSequence
36-52VKKSSVKRKRGTRVSKS
Subcellular Location(s) nucl 17, cyto 5, mito 2, pero 1, cysk 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
IPR036322  WD40_repeat_dom_sf  
Amino Acid Sequences MLATGNQVGKIYLWDTKDIPYYIDGYIEKKKAEYLVKKSSVKRKRGTRVSKSAVIKKPIILESDCKSTIRQIDFSKNSQWIVSVCDDGSIWCWKSNIDTTFQESIKGSGSSDDPLIID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.21
4 0.25
5 0.24
6 0.23
7 0.2
8 0.2
9 0.17
10 0.19
11 0.18
12 0.18
13 0.23
14 0.24
15 0.23
16 0.21
17 0.22
18 0.24
19 0.32
20 0.36
21 0.38
22 0.45
23 0.52
24 0.57
25 0.62
26 0.68
27 0.68
28 0.69
29 0.69
30 0.7
31 0.73
32 0.78
33 0.81
34 0.8
35 0.8
36 0.77
37 0.76
38 0.72
39 0.7
40 0.65
41 0.59
42 0.51
43 0.42
44 0.39
45 0.33
46 0.3
47 0.22
48 0.2
49 0.19
50 0.22
51 0.22
52 0.19
53 0.18
54 0.19
55 0.23
56 0.22
57 0.24
58 0.23
59 0.31
60 0.34
61 0.36
62 0.37
63 0.34
64 0.33
65 0.28
66 0.26
67 0.18
68 0.18
69 0.17
70 0.14
71 0.12
72 0.12
73 0.12
74 0.11
75 0.13
76 0.14
77 0.14
78 0.14
79 0.15
80 0.15
81 0.18
82 0.25
83 0.24
84 0.25
85 0.27
86 0.31
87 0.36
88 0.36
89 0.35
90 0.29
91 0.28
92 0.25
93 0.23
94 0.18
95 0.14
96 0.16
97 0.16
98 0.16