Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015LJ47

Protein Details
Accession A0A015LJ47    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
32-56DYMLQFCQKSRRQRITQRNRTERLSHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 22, nucl 4.5, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008631  Glycogen_synth  
Gene Ontology GO:0004373  F:glycogen (starch) synthase activity  
GO:0005978  P:glycogen biosynthetic process  
Pfam View protein in Pfam  
PF05693  Glycogen_syn  
Amino Acid Sequences MEEILETPADYGIHIVDRRTRSTEESINQMADYMLQFCQKSRRQRITQRNRTERLSDLLDWKIMGMEYVRARKLALYRTYPDSFAGAEAGEFESYIKAKIPKPLSAPGSPRIKGSGSVADDEEITEGMSNFNIIDEENEETR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.2
4 0.24
5 0.27
6 0.31
7 0.32
8 0.32
9 0.37
10 0.42
11 0.38
12 0.41
13 0.39
14 0.36
15 0.33
16 0.29
17 0.23
18 0.17
19 0.14
20 0.1
21 0.09
22 0.11
23 0.11
24 0.12
25 0.21
26 0.27
27 0.37
28 0.45
29 0.54
30 0.6
31 0.71
32 0.81
33 0.84
34 0.88
35 0.88
36 0.87
37 0.82
38 0.76
39 0.68
40 0.59
41 0.51
42 0.44
43 0.35
44 0.29
45 0.25
46 0.22
47 0.19
48 0.17
49 0.13
50 0.09
51 0.08
52 0.05
53 0.07
54 0.1
55 0.13
56 0.13
57 0.13
58 0.13
59 0.15
60 0.17
61 0.2
62 0.22
63 0.23
64 0.25
65 0.31
66 0.32
67 0.31
68 0.29
69 0.23
70 0.19
71 0.15
72 0.13
73 0.07
74 0.06
75 0.06
76 0.06
77 0.05
78 0.05
79 0.05
80 0.06
81 0.06
82 0.07
83 0.08
84 0.12
85 0.14
86 0.22
87 0.25
88 0.28
89 0.32
90 0.39
91 0.41
92 0.42
93 0.44
94 0.44
95 0.48
96 0.45
97 0.42
98 0.38
99 0.34
100 0.3
101 0.3
102 0.29
103 0.24
104 0.25
105 0.25
106 0.23
107 0.21
108 0.2
109 0.17
110 0.1
111 0.08
112 0.07
113 0.07
114 0.07
115 0.06
116 0.06
117 0.06
118 0.06
119 0.06
120 0.06
121 0.07
122 0.09