Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015K8R5

Protein Details
Accession A0A015K8R5    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
17-44SHTTHSTQSSKTRKKRKANIVSDHKNDSHydrophilic
NLS Segment(s)
PositionSequence
30-32KKR
Subcellular Location(s) nucl 22, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003656  Znf_BED  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF02892  zf-BED  
Amino Acid Sequences MSASMFYPSDADSDEDSHTTHSTQSSKTRKKRKANIVSDHKNDSDLVYCKICEYDLSGSYRKPYAYTRKGGNTSSMIAHLRDKHGITKDNFTNYLDEYREPKWDQSHQTQVTDYYSSSKPCPAKRQELSARKLIQFIIHFVLPLYILQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.16
4 0.17
5 0.17
6 0.15
7 0.15
8 0.17
9 0.18
10 0.22
11 0.31
12 0.4
13 0.5
14 0.59
15 0.68
16 0.74
17 0.82
18 0.88
19 0.89
20 0.89
21 0.89
22 0.9
23 0.9
24 0.88
25 0.82
26 0.76
27 0.65
28 0.55
29 0.45
30 0.35
31 0.29
32 0.23
33 0.21
34 0.18
35 0.17
36 0.17
37 0.17
38 0.15
39 0.11
40 0.12
41 0.12
42 0.14
43 0.18
44 0.19
45 0.19
46 0.21
47 0.22
48 0.19
49 0.18
50 0.21
51 0.27
52 0.32
53 0.36
54 0.38
55 0.42
56 0.45
57 0.44
58 0.4
59 0.31
60 0.26
61 0.23
62 0.2
63 0.16
64 0.14
65 0.16
66 0.15
67 0.15
68 0.16
69 0.16
70 0.18
71 0.21
72 0.26
73 0.25
74 0.3
75 0.31
76 0.32
77 0.33
78 0.29
79 0.27
80 0.23
81 0.24
82 0.19
83 0.18
84 0.18
85 0.18
86 0.22
87 0.22
88 0.24
89 0.26
90 0.31
91 0.35
92 0.38
93 0.47
94 0.44
95 0.44
96 0.42
97 0.39
98 0.35
99 0.3
100 0.24
101 0.19
102 0.19
103 0.2
104 0.2
105 0.26
106 0.3
107 0.35
108 0.45
109 0.48
110 0.56
111 0.58
112 0.66
113 0.7
114 0.73
115 0.72
116 0.71
117 0.68
118 0.59
119 0.57
120 0.48
121 0.43
122 0.35
123 0.33
124 0.29
125 0.23
126 0.22
127 0.2
128 0.2
129 0.15