Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015I987

Protein Details
Accession A0A015I987   
Localization Confidence High
Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-45MGIFKDLKRKKKRVKDSSDEGERDLDNIEKQKKNKKIKNILKIDLHydrophilic
NLS Segment(s)
PositionSequence
8-15KRKKKRVK
32-36KKNKK
Subcellular Location(s) nucl 21, cyto 3, mito 2
Family & Domain DBs
Amino Acid Sequences MGIFKDLKRKKKRVKDSSDEGERDLDNIEKQKKNKKIKNILKIDLAEKTKDDVFRLGNSDRFKIANQHAGYVSFYFKQCFKVLVWRGLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.9
3 0.89
4 0.88
5 0.85
6 0.76
7 0.65
8 0.57
9 0.46
10 0.38
11 0.3
12 0.21
13 0.15
14 0.21
15 0.27
16 0.29
17 0.34
18 0.43
19 0.52
20 0.61
21 0.65
22 0.69
23 0.73
24 0.77
25 0.82
26 0.8
27 0.73
28 0.67
29 0.62
30 0.52
31 0.46
32 0.38
33 0.28
34 0.21
35 0.2
36 0.18
37 0.17
38 0.17
39 0.14
40 0.15
41 0.15
42 0.19
43 0.19
44 0.22
45 0.24
46 0.24
47 0.23
48 0.23
49 0.22
50 0.25
51 0.27
52 0.3
53 0.29
54 0.3
55 0.29
56 0.29
57 0.3
58 0.24
59 0.23
60 0.18
61 0.18
62 0.18
63 0.19
64 0.22
65 0.21
66 0.22
67 0.22
68 0.29
69 0.34