Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015L1X6

Protein Details
Accession A0A015L1X6    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
109-129NFLSNNTQSSKRREKKAKKNYHydrophilic
NLS Segment(s)
PositionSequence
119-127KRREKKAKK
Subcellular Location(s) nucl 14.5, cyto_nucl 13.833, cyto 10, cyto_pero 5.999
Family & Domain DBs
Amino Acid Sequences MESEEETEETEVLINENPTQENTNVNTSRYAYNNINQELKNILSKVFVNPSLECYNEIEKAYYSAKFLPVYFNCDSTEYVMPVPEKQYSYCEAYTTDSHVPIKTGKGLNFLSNNTQSSKRREKKAKKNY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.12
4 0.13
5 0.14
6 0.17
7 0.16
8 0.19
9 0.2
10 0.27
11 0.27
12 0.28
13 0.28
14 0.27
15 0.3
16 0.28
17 0.3
18 0.25
19 0.28
20 0.33
21 0.34
22 0.36
23 0.33
24 0.32
25 0.29
26 0.27
27 0.25
28 0.19
29 0.17
30 0.14
31 0.15
32 0.16
33 0.17
34 0.17
35 0.17
36 0.16
37 0.21
38 0.2
39 0.2
40 0.19
41 0.18
42 0.18
43 0.18
44 0.18
45 0.14
46 0.12
47 0.14
48 0.14
49 0.12
50 0.12
51 0.1
52 0.12
53 0.12
54 0.12
55 0.16
56 0.15
57 0.21
58 0.21
59 0.21
60 0.2
61 0.21
62 0.21
63 0.19
64 0.19
65 0.14
66 0.13
67 0.14
68 0.14
69 0.13
70 0.15
71 0.14
72 0.14
73 0.14
74 0.16
75 0.18
76 0.22
77 0.21
78 0.2
79 0.19
80 0.21
81 0.21
82 0.23
83 0.22
84 0.2
85 0.21
86 0.21
87 0.21
88 0.19
89 0.21
90 0.22
91 0.25
92 0.23
93 0.28
94 0.29
95 0.33
96 0.34
97 0.35
98 0.35
99 0.35
100 0.35
101 0.33
102 0.39
103 0.39
104 0.45
105 0.54
106 0.56
107 0.63
108 0.73
109 0.8