Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015IW98

Protein Details
Accession A0A015IW98    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
65-86VYKDTKRYSRVKVKNDNSSWRKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MEKEIFRLKETIDKSIVIFLEKDGDVCWKNYIGRETKKTEKSSYPTLKKDEYLDMVKMFEENQSVYKDTKRYSRVKVKNDNSSWRKVFKEVEKWRKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.29
3 0.28
4 0.21
5 0.19
6 0.14
7 0.16
8 0.15
9 0.15
10 0.11
11 0.15
12 0.15
13 0.16
14 0.17
15 0.15
16 0.16
17 0.19
18 0.24
19 0.27
20 0.33
21 0.37
22 0.42
23 0.49
24 0.55
25 0.55
26 0.54
27 0.52
28 0.5
29 0.55
30 0.58
31 0.56
32 0.53
33 0.53
34 0.5
35 0.46
36 0.43
37 0.35
38 0.29
39 0.24
40 0.21
41 0.18
42 0.17
43 0.16
44 0.14
45 0.12
46 0.09
47 0.08
48 0.07
49 0.09
50 0.11
51 0.13
52 0.14
53 0.17
54 0.2
55 0.22
56 0.29
57 0.34
58 0.39
59 0.47
60 0.56
61 0.62
62 0.68
63 0.77
64 0.77
65 0.8
66 0.8
67 0.81
68 0.76
69 0.76
70 0.71
71 0.65
72 0.6
73 0.54
74 0.56
75 0.54
76 0.6
77 0.62