Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015JDN2

Protein Details
Accession A0A015JDN2   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
86-107SSRVSRVSSEKQKKPKICKFGWHydrophilic
NLS Segment(s)
PositionSequence
35-100RRTGNSKIRSGGLPKKGKPRNQGSGGLPKKGKPRNQGSGGLPKKGKPRNQDSSRVSRVSSEKQKKP
Subcellular Location(s) nucl 16, mito 10, cyto_nucl 9.5
Family & Domain DBs
Amino Acid Sequences MKGDGFPKEYFKIRSGGLPKNGKPKDLIGWASVFRRTGNSKIRSGGLPKKGKPRNQGSGGLPKKGKPRNQGSGGLPKKGKPRNQDSSRVSRVSSEKQKKPKICKFGWIAKEQSKIHIYEYMNHVIVELYLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.4
3 0.43
4 0.47
5 0.52
6 0.54
7 0.62
8 0.62
9 0.55
10 0.51
11 0.46
12 0.43
13 0.4
14 0.38
15 0.29
16 0.3
17 0.31
18 0.3
19 0.29
20 0.24
21 0.18
22 0.2
23 0.22
24 0.27
25 0.34
26 0.37
27 0.37
28 0.39
29 0.4
30 0.38
31 0.41
32 0.42
33 0.42
34 0.44
35 0.46
36 0.54
37 0.59
38 0.64
39 0.66
40 0.66
41 0.65
42 0.62
43 0.63
44 0.56
45 0.6
46 0.56
47 0.51
48 0.44
49 0.39
50 0.43
51 0.45
52 0.48
53 0.46
54 0.52
55 0.55
56 0.59
57 0.61
58 0.56
59 0.6
60 0.56
61 0.51
62 0.44
63 0.39
64 0.43
65 0.45
66 0.47
67 0.45
68 0.52
69 0.58
70 0.63
71 0.69
72 0.67
73 0.69
74 0.69
75 0.62
76 0.53
77 0.47
78 0.46
79 0.45
80 0.5
81 0.51
82 0.53
83 0.62
84 0.71
85 0.75
86 0.81
87 0.81
88 0.8
89 0.73
90 0.73
91 0.71
92 0.71
93 0.69
94 0.64
95 0.61
96 0.58
97 0.63
98 0.55
99 0.54
100 0.48
101 0.42
102 0.39
103 0.39
104 0.35
105 0.33
106 0.37
107 0.37
108 0.34
109 0.32
110 0.3
111 0.23