Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015LA78

Protein Details
Accession A0A015LA78    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MDTLIKKLKIDKKCKKCKFKCNAIYFQQNFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito_nucl 10, mito 7.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MDTLIKKLKIDKKCKKCKFKCNAIYFQQNFKNWTSGNKYIDKFIQDTQLSAHYNTKEALEWIPYDRFYDIKYIEKKKMYRANWIDGYIYEWDDENQNGRRNGENMSVGLVDLKNSNNSKNIELELTNKVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.91
3 0.92
4 0.93
5 0.92
6 0.93
7 0.92
8 0.89
9 0.88
10 0.83
11 0.84
12 0.76
13 0.73
14 0.69
15 0.61
16 0.55
17 0.48
18 0.45
19 0.35
20 0.38
21 0.38
22 0.38
23 0.4
24 0.43
25 0.42
26 0.41
27 0.42
28 0.38
29 0.33
30 0.27
31 0.3
32 0.23
33 0.23
34 0.21
35 0.24
36 0.22
37 0.21
38 0.24
39 0.17
40 0.18
41 0.18
42 0.17
43 0.13
44 0.13
45 0.12
46 0.09
47 0.1
48 0.11
49 0.11
50 0.11
51 0.12
52 0.11
53 0.11
54 0.1
55 0.13
56 0.12
57 0.18
58 0.25
59 0.29
60 0.34
61 0.39
62 0.4
63 0.45
64 0.52
65 0.47
66 0.51
67 0.51
68 0.53
69 0.5
70 0.49
71 0.41
72 0.32
73 0.33
74 0.23
75 0.19
76 0.12
77 0.1
78 0.09
79 0.1
80 0.11
81 0.13
82 0.17
83 0.23
84 0.24
85 0.26
86 0.28
87 0.28
88 0.3
89 0.3
90 0.26
91 0.21
92 0.21
93 0.19
94 0.17
95 0.18
96 0.15
97 0.11
98 0.11
99 0.13
100 0.18
101 0.19
102 0.22
103 0.26
104 0.28
105 0.3
106 0.31
107 0.32
108 0.28
109 0.28
110 0.29