Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015LCS0

Protein Details
Accession A0A015LCS0    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
11-38TGKRITTYKEIKKPPQRIQNRNNNDKPIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 12, mito 8
Family & Domain DBs
Amino Acid Sequences MLLIKQITDATGKRITTYKEIKKPPQRIQNRNNNDKPIFIRPIYKQLIISFEDKAAADYLLEQDWCLAIEDSVARILPGNPKHPIYTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.34
4 0.43
5 0.47
6 0.51
7 0.59
8 0.67
9 0.73
10 0.79
11 0.8
12 0.81
13 0.82
14 0.83
15 0.85
16 0.85
17 0.85
18 0.86
19 0.81
20 0.78
21 0.68
22 0.61
23 0.54
24 0.49
25 0.43
26 0.34
27 0.34
28 0.28
29 0.35
30 0.35
31 0.32
32 0.27
33 0.24
34 0.26
35 0.23
36 0.23
37 0.16
38 0.14
39 0.14
40 0.13
41 0.13
42 0.1
43 0.08
44 0.06
45 0.06
46 0.07
47 0.07
48 0.07
49 0.06
50 0.06
51 0.06
52 0.07
53 0.08
54 0.07
55 0.06
56 0.07
57 0.08
58 0.08
59 0.09
60 0.08
61 0.07
62 0.08
63 0.1
64 0.17
65 0.22
66 0.26
67 0.3
68 0.33