Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q1E3Z7

Protein Details
Accession Q1E3Z7    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
329-353AADRPPAATKDKGKKRKSKIGSMSQHydrophilic
NLS Segment(s)
PositionSequence
327-348GKAADRPPAATKDKGKKRKSKI
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007018  Mediator_Med6  
IPR038566  Mediator_Med6_sf  
Gene Ontology GO:0016592  C:mediator complex  
GO:0003712  F:transcription coregulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
KEGG cim:CIMG_02716  -  
Pfam View protein in Pfam  
PF04934  Med6  
Amino Acid Sequences MEPSPDVPLEEITWHSPQHVQMMGGFLHSNNILFYFAESPFFDPTSNNASLALQAMHNENLRPFIETRGAFEGRLKTMQGLEFIVAHDPLLEAAAANAAAVARGEQPKEASNVWVIRKQMRRRSAAMGGQDDVQVLATYFVVGDSVFMAPSVWSVVGRRMLSTVTSLTKVLSTASALLTFSPSYGHSYLPHVPKSLEPTQLGQQSAQQSKETTPMPDMSGDKTTSRSALADASTTTLNASALQDARDFAETLNLLARYGNEYIDETPLAGEPGSFIFTKASASAAEQLSVAGAGAQASRQNIRSGATTPVPFGAGRPASVQPDSTKGKAADRPPAATKDKGKKRKSKIGSMSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.22
4 0.23
5 0.26
6 0.26
7 0.22
8 0.21
9 0.24
10 0.22
11 0.2
12 0.19
13 0.14
14 0.14
15 0.14
16 0.13
17 0.1
18 0.11
19 0.1
20 0.1
21 0.12
22 0.13
23 0.13
24 0.15
25 0.16
26 0.17
27 0.19
28 0.19
29 0.18
30 0.15
31 0.19
32 0.23
33 0.23
34 0.21
35 0.19
36 0.19
37 0.19
38 0.2
39 0.17
40 0.1
41 0.11
42 0.13
43 0.15
44 0.16
45 0.16
46 0.15
47 0.18
48 0.18
49 0.2
50 0.18
51 0.19
52 0.25
53 0.24
54 0.27
55 0.29
56 0.3
57 0.27
58 0.31
59 0.31
60 0.27
61 0.29
62 0.25
63 0.2
64 0.22
65 0.23
66 0.2
67 0.16
68 0.14
69 0.13
70 0.13
71 0.13
72 0.1
73 0.09
74 0.08
75 0.07
76 0.06
77 0.06
78 0.05
79 0.04
80 0.04
81 0.04
82 0.04
83 0.03
84 0.04
85 0.03
86 0.03
87 0.03
88 0.04
89 0.07
90 0.1
91 0.11
92 0.11
93 0.13
94 0.15
95 0.18
96 0.17
97 0.15
98 0.17
99 0.22
100 0.24
101 0.25
102 0.26
103 0.31
104 0.39
105 0.46
106 0.5
107 0.53
108 0.55
109 0.56
110 0.59
111 0.58
112 0.53
113 0.49
114 0.42
115 0.35
116 0.31
117 0.28
118 0.22
119 0.16
120 0.12
121 0.07
122 0.05
123 0.05
124 0.04
125 0.04
126 0.04
127 0.03
128 0.03
129 0.03
130 0.03
131 0.04
132 0.04
133 0.04
134 0.04
135 0.04
136 0.04
137 0.04
138 0.05
139 0.04
140 0.04
141 0.05
142 0.08
143 0.12
144 0.12
145 0.12
146 0.12
147 0.12
148 0.12
149 0.13
150 0.12
151 0.09
152 0.1
153 0.1
154 0.1
155 0.1
156 0.09
157 0.08
158 0.07
159 0.06
160 0.06
161 0.06
162 0.06
163 0.06
164 0.06
165 0.06
166 0.06
167 0.06
168 0.06
169 0.06
170 0.09
171 0.1
172 0.1
173 0.1
174 0.14
175 0.2
176 0.23
177 0.24
178 0.21
179 0.21
180 0.22
181 0.28
182 0.28
183 0.26
184 0.23
185 0.24
186 0.28
187 0.3
188 0.29
189 0.23
190 0.23
191 0.25
192 0.27
193 0.26
194 0.22
195 0.2
196 0.21
197 0.24
198 0.22
199 0.17
200 0.16
201 0.16
202 0.16
203 0.18
204 0.18
205 0.16
206 0.18
207 0.18
208 0.17
209 0.18
210 0.17
211 0.16
212 0.15
213 0.13
214 0.11
215 0.12
216 0.12
217 0.1
218 0.1
219 0.1
220 0.1
221 0.09
222 0.09
223 0.07
224 0.07
225 0.07
226 0.07
227 0.08
228 0.09
229 0.09
230 0.1
231 0.1
232 0.11
233 0.11
234 0.11
235 0.09
236 0.12
237 0.11
238 0.11
239 0.14
240 0.13
241 0.12
242 0.12
243 0.12
244 0.11
245 0.12
246 0.12
247 0.1
248 0.11
249 0.12
250 0.14
251 0.13
252 0.1
253 0.1
254 0.1
255 0.09
256 0.08
257 0.06
258 0.05
259 0.06
260 0.08
261 0.08
262 0.08
263 0.08
264 0.09
265 0.1
266 0.09
267 0.1
268 0.08
269 0.1
270 0.14
271 0.14
272 0.14
273 0.13
274 0.13
275 0.12
276 0.11
277 0.1
278 0.04
279 0.04
280 0.04
281 0.04
282 0.05
283 0.07
284 0.1
285 0.13
286 0.14
287 0.16
288 0.17
289 0.18
290 0.2
291 0.2
292 0.23
293 0.26
294 0.25
295 0.24
296 0.24
297 0.23
298 0.21
299 0.2
300 0.23
301 0.19
302 0.19
303 0.21
304 0.23
305 0.26
306 0.27
307 0.29
308 0.23
309 0.29
310 0.34
311 0.32
312 0.35
313 0.32
314 0.38
315 0.43
316 0.46
317 0.48
318 0.47
319 0.51
320 0.5
321 0.56
322 0.55
323 0.55
324 0.6
325 0.61
326 0.67
327 0.72
328 0.77
329 0.8
330 0.86
331 0.89
332 0.88
333 0.88