Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015MYW4

Protein Details
Accession A0A015MYW4    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
20-43NSDGNERRQKRKNIDRIYKRRARIBasic
NLS Segment(s)
PositionSequence
26-41RRQKRKNIDRIYKRRA
Subcellular Location(s) nucl 17.5, mito_nucl 13, mito 7.5
Family & Domain DBs
Amino Acid Sequences MEPNNIMRTSVFNRRQRRFNSDGNERRQKRKNIDRIYKRRARIPVNNEDTLSRIAQLPLQITNDSFASQLFHGSPFY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.7
3 0.7
4 0.73
5 0.69
6 0.67
7 0.67
8 0.68
9 0.7
10 0.71
11 0.75
12 0.71
13 0.73
14 0.74
15 0.73
16 0.72
17 0.74
18 0.75
19 0.75
20 0.82
21 0.84
22 0.86
23 0.87
24 0.84
25 0.75
26 0.71
27 0.67
28 0.63
29 0.61
30 0.58
31 0.59
32 0.58
33 0.58
34 0.52
35 0.46
36 0.4
37 0.34
38 0.27
39 0.17
40 0.12
41 0.11
42 0.12
43 0.13
44 0.13
45 0.13
46 0.15
47 0.15
48 0.14
49 0.16
50 0.15
51 0.14
52 0.13
53 0.11
54 0.11
55 0.1
56 0.13
57 0.12